Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1120 IGR1123 IGR1125 IGR1127 IGR1124 IGR1119 IGR1128 IGR1121 IGR1122 IGR1129 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1547 HD1520 HD1525 HD1532 HD1529 HD1535 HD1541 HD1546 HD1540 HD1542 HD1543 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1547 HD1520 HD1525 HD1532 HD1529 HD1535 HD1541 HD1546 HD1540 HD1542 HD1543 HD1538 HD1533 HD1547 HD1532 HD1529 HD1522 HD1524 HD1530 eha, - HD1528 HD1530 eha, - HD1528 HD1520 HD1526 HD1539 HD1534 HD1525 HD1526 HD1537 HD1523 HD1524 HD1522 HD1535 HD1540 HD1542 HD1543 HD1545 HD1546 HD1541 HD1545
* Calculated from Protein Sequence

Gene ID: HD1532

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1268872

Gene Stop:
1267910

Gene Length:
963

Molecular Weight*:
35977

pI*:
4.60

Net Charge*:
-19.84

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two Blast hits to hypothetical proteins of Neisseria meningitidis are observed:

Residues 107 to 291 are 27% ( EScore : 2e-08 ) identical to gb|AAF41403.1| (AE002451) hypothetical protein between residues 73 and 277 in [Neisseria meningitidis MC58]
Residues 107 to 291 are 26% ( EScore : 6e-08 ) identical to emb|CAB84482.1| (AL162755) hypothetical protein NMA1222 between residues 73 and 277 in [Neisseria meningitidis]

See also the similarity to 15641803 hypothetical protein
[Vibrio cholerae].

COGS Summary:  COGS Search
BeTs to 3 clades of COG1196
COG name: Chromosome segregation ATPases
Functional Class: D
The phylogenetic pattern of COG1196 is am-kYqvc-br---gpol---
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-254 are 28% similar to a (PROTEOME VC1800 COMPLETE) protein domain (PD319731) which is seen in Q9KR46_VIBCH.



Paralogs:  Local Blast Search
HD1532 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSELTLSQEQNAVALAAKAMTQDLAEAHEAMGMIKAFTFVGKLATVATLK
KLAEVKEARNYKGLQYVNADGELATVASWEEFCTACGTSRRKVDEDLQNL
NQFGEEFMETSQRLGLGYREMRKLRQLPEEARAEIVDADYSETTDKEDLI
EKIEDLTAKHAKEKESLTKQLESVKANYDAQAKVIANKDERLNKLDKELA
KKTLLIETQTPDQRGGMLREEAAQISYKAEAILRGQVFQAFEALQTHQEE
HGIDHRQFMSGVLAEYQLILSELKERFNLTDEPTGDNLPEWAKPEYADKP
SVEPSIAAILDEVSDAQIVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGAATTAACGTTAAGCCAAGAACAGAATGCGGTGGCGTTAGCAGC
CAAGGCGATGACGCAGGATTTAGCGGAAGCCCACGAAGCGATGGGAATGA
TTAAAGCATTTACTTTTGTAGGAAAACTGGCGACGGTCGCCACTTTGAAA
AAACTGGCAGAAGTCAAAGAAGCTAGAAATTACAAGGGTTTGCAGTATGT
GAACGCTGATGGAGAACTGGCGACGGTCGCCAGTTGGGAAGAATTTTGTA
CCGCTTGCGGAACCAGTCGCAGAAAGGTTGATGAAGACCTTCAAAACTTA
AATCAATTTGGTGAAGAGTTTATGGAAACCAGCCAACGCCTAGGCTTGGG
TTACCGTGAAATGCGAAAACTTCGCCAGTTGCCGGAAGAAGCCCGAGCGG
AGATTGTGGATGCGGATTATTCGGAAACCACCGACAAGGAAGATTTGATT
GAGAAAATCGAAGATTTAACCGCTAAGCACGCCAAGGAAAAAGAGAGCCT
GACCAAGCAACTGGAAAGCGTGAAAGCAAACTACGATGCACAGGCGAAAG
TGATTGCTAATAAGGACGAACGTTTAAACAAACTGGATAAGGAATTGGCG
AAGAAAACCCTGCTGATAGAAACCCAAACGCCAGACCAACGTGGTGGAAT
GTTGAGAGAAGAAGCTGCACAGATTAGCTACAAAGCGGAAGCCATTTTGC
GTGGGCAGGTGTTTCAGGCTTTTGAAGCCTTACAAACTCATCAAGAAGAA
CACGGTATTGACCATCGTCAGTTTATGAGTGGTGTGCTTGCCGAGTATCA
GTTGATTTTATCGGAGCTTAAAGAACGCTTTAACTTAACCGATGAACCAA
CGGGCGATAACCTGCCTGAATGGGCAAAACCTGAATACGCTGATAAGCCT
TCGGTTGAACCGAGTATAGCGGCAATTTTAGACGAAGTAAGCGATGCACA
AATCGTGGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy