Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1120 IGR1123 IGR1125 IGR1127 IGR1124 IGR1119 IGR1128 IGR1121 IGR1122 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1518 HD1520 HD1525 HD1532 HD1529 HD1535 HD1541 HD1540 HD1542 HD1543 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1518 HD1520 HD1525 HD1532 HD1529 HD1535 HD1541 HD1540 HD1542 HD1543 HD1538 HD1533 HD1532 HD1529 HD1522 HD1524 HD1519 HD1530 eha, - HD1528 HD1530 eha, - HD1528 HD1520 HD1526 HD1539 HD1534 HD1525 HD1518 HD1526 HD1537 HD1523 HD1519 HD1524 HD1522 HD1535 HD1540 HD1542 HD1543 HD1545 HD1545 HD1541
* Calculated from Protein Sequence

Gene ID: HD1530

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1267929

Gene Stop:
1267351

Gene Length:
579

Molecular Weight*:
22203

pI*:
11.00

Net Charge*:
17.06

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 12-180 are 42% similar to residues 3-171 of 16760398 hypothetical protein[Salmonella enterica subsp. enterica serovar Typhi]. No other matches in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 31-179 are 26% similar to a (PROTEOME COMPLETE VC1799) protein domain (PD325513) which is seen in Q9KR47_VIBCH.



Paralogs:  Local Blast Search
HD1530 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MHKSWSKDDAMAILPSVLSHWANRVETAKFGETEKVIDEGCKQTGLSRAT
FLRQIKPYRPKSNRKVRSDKGKHQLEKAELDLISAAWLHLRQKNGKTMAT
LERVLDILRANHRIKAEFIDENTGEVRPYSATSVERALRNANLHPDQLLR
PAPVVQLQSKHPNHVWQIDPSLCAVLLKRNRQRQWVVHYGRR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACAAATCGTGGAGTAAGGACGATGCAATGGCAATTTTACCGAGTGT
GCTATCCCACTGGGCAAACCGTGTGGAGACGGCAAAGTTTGGCGAGACGG
AGAAAGTTATTGACGAAGGCTGTAAGCAAACAGGATTAAGCCGAGCCACT
TTCTTACGCCAAATTAAACCCTACCGTCCTAAAAGCAATCGTAAAGTGCG
GTCGGATAAAGGCAAGCATCAGCTAGAAAAAGCTGAGCTTGATTTGATTA
GTGCTGCTTGGTTGCACCTTAGACAGAAAAACGGCAAGACGATGGCAACA
TTAGAACGCGTATTGGATATTCTACGAGCAAATCATCGTATTAAAGCTGA
ATTTATCGACGAAAATACTGGTGAAGTTCGTCCTTATTCCGCTACTTCAG
TGGAGCGTGCATTACGCAATGCCAATTTGCACCCTGACCAATTGTTACGC
CCCGCCCCTGTGGTTCAGTTGCAAAGTAAGCACCCAAACCACGTGTGGCA
AATCGACCCGTCATTGTGTGCTGTATTACTTAAAAGAAACAGGCAAAGGC
AATGGGTTGTGCATTATGGAAGAAGGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy