Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1120 IGR1123 IGR1125 IGR1127 IGR1124 IGR1119 IGR1128 IGR1121 IGR1122 IGR1118 IGR1117 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1517 HD1518 HD1520 HD1525 HD1532 HD1529 HD1535 HD1541 HD1540 HD1542 HD1543 yejM, - HD1516 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1517 HD1518 HD1520 HD1525 HD1532 HD1529 HD1535 HD1541 HD1540 HD1542 HD1543 yejM, - HD1516 HD1538 HD1533 HD1532 HD1529 HD1522 HD1524 HD1519 HD1530 eha, - HD1528 HD1530 eha, - HD1528 HD1518 HD1520 HD1526 HD1539 HD1534 HD1525 HD1519 HD1517 HD1526 HD1537 HD1523 HD1524 HD1522 HD1535 HD1540 HD1543 yejM, - HD1516 HD1542 HD1541
* Calculated from Protein Sequence

Gene ID: HD1529

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1267373

Gene Stop:
1266099

Gene Length:
1275

Molecular Weight*:
49148

pI*:
6.90

Net Charge*:
-0.34

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-401 are 42% similar to residues 176-569 of 16760398 hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi]. Residues 1-377 are 32% similar to residues 167-558 of 15641802 hypothetical protein [Vibrio cholerae].



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-345 are 33% similar to a (PROTEOME COMPLETE VC1799) protein domain (PD325513) which is seen in Q9KR47_VIBCH.



Paralogs:  Local Blast Search
HD1529 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 170 (E-value = 2.1e-08) place HD1529 in the rve family which is described as Integrase core domain (PF00665)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LCIMEEGEFYKNKPANVAKVEPQRVWRYVITDHTSGVIYVEYVYGGETAE
NVSQCFINAIQPKANKAEPFFGVPKILMFDRGTANTSQMFSHLLHQLDVK
VEIPKAKNARAKGQVEKGNDIVERQFESGLRFMNVSGLDELNQLAHQWMR
YFNGKMVHSRHGRTRYQMWQFIRPEQLIMPPSREICQELMITALSERVVS
DKLEISFESRRYDVRDVPDAKVGEKITVGKNPYRPECVQVQCFERVVDED
GSENLKPYWVVVEPVEVNEYGFRVDAAMIGEEYKAHKKTEFETHKEQAEQ
LAYGVTNEDDLKRAKKVNKPLFNGEINPYKHIEETNLNWFVPKKGQDHEL
TTNARRVEQKPVNLVECAKQLKERFPEWNGKHYKNLAKHFSEGVPITTLE
DWLQGNKLPEVLNPETKILQLNAA$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTGCATTATGGAAGAAGGTGAGTTTTACAAAAACAAGCCTGCCAATGT
AGCGAAAGTCGAGCCACAACGAGTATGGCGATATGTCATTACTGACCACA
CATCAGGCGTGATTTATGTGGAATATGTGTACGGCGGTGAAACGGCAGAA
AACGTGAGCCAATGCTTTATTAACGCTATTCAACCAAAAGCCAATAAGGC
TGAACCGTTTTTCGGTGTGCCGAAAATTTTGATGTTTGACCGAGGTACAG
CAAATACCTCACAAATGTTCAGCCACTTACTGCATCAGCTTGATGTGAAA
GTGGAAATCCCGAAAGCCAAAAACGCCCGAGCTAAAGGGCAAGTGGAAAA
AGGCAACGATATTGTAGAGCGACAATTTGAGAGCGGCTTGCGGTTTATGA
ATGTATCAGGGCTTGATGAGTTAAATCAACTTGCCCATCAATGGATGCGA
TATTTTAACGGCAAAATGGTGCATTCACGCCACGGTCGGACACGCTATCA
AATGTGGCAATTTATTCGCCCCGAGCAATTGATTATGCCTCCGAGCCGAG
AAATTTGCCAAGAACTGATGATTACCGCACTTTCCGAGCGTGTAGTTAGC
GACAAATTGGAAATTAGCTTTGAAAGCCGCCGTTACGATGTACGTGATGT
GCCTGATGCAAAAGTGGGCGAGAAAATCACAGTGGGTAAGAATCCGTATC
GCCCTGAATGTGTGCAGGTTCAATGTTTTGAGCGTGTTGTTGATGAAGAC
GGTTCGGAAAACCTGAAACCTTATTGGGTGGTAGTTGAGCCAGTTGAAGT
CAATGAATATGGCTTCCGTGTGGACGCTGCGATGATTGGTGAAGAATATA
AGGCTCATAAGAAAACCGAGTTTGAAACCCATAAAGAGCAAGCTGAACAG
CTGGCTTACGGTGTAACCAATGAAGATGATTTGAAACGTGCGAAAAAGGT
AAATAAACCGTTATTTAACGGCGAAATTAACCCTTACAAGCATATTGAAG
AAACGAATTTGAACTGGTTTGTACCGAAAAAAGGACAAGATCATGAACTT
ACTACCAACGCGAGACGTGTGGAACAGAAACCTGTGAATTTGGTGGAATG
TGCAAAACAGTTGAAAGAACGATTCCCTGAATGGAACGGTAAGCATTATA
AAAACTTGGCAAAACATTTTTCCGAGGGCGTGCCGATAACTACGCTGGAA
GATTGGTTGCAGGGCAATAAATTACCTGAAGTTTTAAACCCTGAAACGAA
GATTTTACAGCTGAATGCCGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy