Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1120 IGR1123 IGR1125 IGR1124 IGR1119 IGR1121 IGR1122 IGR1118 IGR1117 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1517 HD1518 HD1520 HD1525 HD1532 HD1529 HD1535 HD1540 yejM, - HD1516 HD1539 HD1537 HD1534 HD1523 HD1538 HD1533 HD1517 HD1518 HD1520 HD1525 HD1532 HD1529 HD1535 HD1540 yejM, - HD1516 HD1538 HD1533 HD1532 HD1529 HD1522 HD1524 HD1519 HD1530 eha, - HD1528 HD1530 eha, - HD1528 HD1518 HD1520 HD1526 HD1539 HD1534 HD1525 HD1519 HD1517 HD1526 HD1537 HD1523 HD1524 HD1522 HD1535 HD1540 yejM, - HD1516
* Calculated from Protein Sequence

Gene ID: HD1528

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
eha  

Definition:
energy converting hydrogenase A (eha) protein

Gene Start:
1266109

Gene Stop:
1264904

Gene Length:
1206

Molecular Weight*:
44768

pI*:
7.80

Net Charge*:
1.92

EC:
 

Functional Class:
Energy metabolism; Other  

Pathway: pathway table

Secondary Evidence:
Tersteegen A, Hedderich R.
Methanobacterium thermoautotrophicum encodes two multisubunit membrane-bound [NiFe] hydrogenases. Transcription of the
operons and sequence analysis of the deduced proteins.
Eur J Biochem. 1999 Sep;264(3):930-43.
PMID: 10491142

Comment:


Blast Summary:  PSI-Blast Search
Residues 174 to 401 are 70% ( EScore : 1e-85 ) identical to gb|AAC64124.1| (AF091717) Eha between residues 94 and 322 in [Salmonella typhi]
Residues 159 to 335 are 32% ( EScore : 8e-12 ) identical to gb|AAA65695.1| (L19085) orf6 between residues 44 and 204 in [Vibrio cholerae]
Residues 121 to 337 are 26% ( EScore : 1e-08 ) identical to sp|P45754|GSPA_AERHY GENERAL SECRETION PATHWAY PROTEIN A >2126219|pir||I39593 exeA protein - Aeromonas hydrophila >551216|emb|CAA57225.1| between residues 6 and 209 in [Aeromonas hydrophila]
Residues 144 to 334 are 27% ( EScore : 1e-06 ) identical to gb|AAF23986.1| (AF043544) unknown between residues 30 and 205 in [Pseudomonas sp. TW3]

COGS Summary:  COGS Search
BeTs to 3 clades of COG0444
COG name: ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
Functional Class: E,P
The phylogenetic pattern of COG0444 is a-TKyqV-EB-Hujgpo-IN-
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 163-312 are 32% similar to a (DNA TRANSPOSITION COMPLETE PROTEOME) protein domain (PD040128) which is seen in Q56674_VIBCH.

Residues 174-225 are 84% similar to a (EHA) protein domain (PD212951) which is seen in O87649_SALTI.

Residues 226-398 are 66% similar to a (COMPLETE PROTEOME A GENERAL) protein domain (PD024030) which is seen in O87649_SALTI.



Paralogs:  Local Blast Search
HD1528 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPPNFDKWRFYVLKLKQVLIDKGVSLRQLAQQMNVSPATVSQLINHNQRV
KQWVEFEKNLGSALQSLGIIEPLASLLEMEGTGESLATEPVPSAPKTTDE
IKDEIMLLAKQALFPATKKHFGLFRDPFAEDVRSADDVFSSADVRYVREA
LFQTAKHGGFMAVVGESGAGKSTLRRDLIDRINQENAPITVIEPYIIAME
DNDVKGKTLKAAHIAEAIISTLSPLESVKRSPEARFRQLHKVLKESVKSG
YSNVLIIEEAHALPIPTLKHLKRFFELEDGFKKLLSIVLIGQPELKIKLS
ERNTEVREVVQRCEIVELAPLDAELERYVEHKLERVGKKLSDIFEEDAFV
AVRQRLTAVGRNKTSQSLLYPLAVGNLLTAAMNLAESLGIPKVNGQVVMN
V$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGCCTAATTTTGATAAATGGAGGTTCTATGTGTTAAAGCTAAAACA
GGTGCTGATTGACAAGGGCGTGAGCCTGCGACAGTTGGCACAACAGATGA
ACGTTTCACCTGCGACGGTTTCACAGTTGATTAACCATAATCAGCGGGTG
AAACAGTGGGTGGAATTTGAGAAGAATTTGGGCAGTGCGTTGCAAAGTTT
GGGGATTATTGAACCGCTTGCAAGCCTGCTTGAAATGGAAGGCACTGGGG
AAAGTTTGGCGACCGAGCCAGTGCCTTCCGCCCCTAAAACCACAGATGAA
ATTAAGGACGAGATTATGTTACTCGCAAAACAGGCTTTATTTCCAGCCAC
AAAGAAACATTTTGGGCTATTTCGTGATCCGTTTGCTGAAGATGTACGCA
GTGCGGACGATGTTTTCAGCTCTGCCGACGTGCGTTATGTACGTGAAGCA
TTATTTCAAACCGCTAAACACGGTGGCTTTATGGCGGTCGTCGGTGAAAG
TGGTGCTGGCAAATCCACGCTCCGCCGTGATTTGATTGATCGCATCAACC
AAGAAAACGCTCCGATTACGGTGATTGAGCCGTATATCATTGCAATGGAA
GACAACGACGTGAAAGGCAAAACATTGAAAGCTGCCCATATCGCCGAAGC
GATTATTTCTACTCTTTCACCGCTTGAAAGCGTGAAACGTTCGCCCGAAG
CACGCTTCCGCCAGTTGCACAAAGTGCTAAAAGAAAGCGTGAAAAGCGGT
TACAGCAATGTGTTAATCATCGAAGAAGCACACGCTTTACCGATTCCAAC
GTTGAAACATTTGAAACGCTTTTTTGAGCTGGAAGATGGCTTTAAAAAAC
TGCTTTCTATTGTGTTGATTGGTCAGCCTGAGTTGAAAATCAAACTTTCT
GAACGTAATACCGAAGTGCGTGAAGTGGTGCAACGTTGTGAAATTGTCGA
ACTTGCACCGCTTGATGCCGAGCTTGAGCGTTATGTGGAACATAAGCTGG
AGCGCGTGGGCAAAAAGCTGAGCGATATTTTTGAAGAAGATGCGTTCGTA
GCAGTTCGACAACGTTTAACTGCGGTAGGACGAAACAAAACGAGCCAAAG
TTTGCTTTATCCGTTAGCTGTAGGAAATTTACTAACTGCAGCAATGAATT
TAGCGGAAAGTTTAGGCATTCCTAAAGTAAATGGACAGGTGGTGATGAAT
GTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy