Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1116 IGR1118 IGR1117 IGR1115 HD1523 HD1517 HD1518 HD1520 HD1525 HD1532 HD1529 HD1513 yejL, - HD1515 yejM, - HD1516 HD1523 HD1517 HD1518 HD1520 HD1525 HD1532 HD1529 HD1513 yejL, - HD1515 yejM, - HD1516 Type: tandem, Name:  - 17 HD1529 HD1513 HD1522 HD1524 HD1519 HD1530 eha, - HD1528 eha, - HD1528 HD1518 HD1520 HD1532 HD1526 HD1525 HD1519 HD1530 HD1517 HD1526 HD1523 HD1524 HD1522 yejL, - HD1515 yejM, - HD1516
* Calculated from Protein Sequence

Gene ID: HD1519

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1263311

Gene Stop:
1262937

Gene Length:
375

Molecular Weight*:
14530

pI*:
9.70

Net Charge*:
4.14

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
A single significant Blast hit to a hypothetical protein of Neisseria meningitidis is observed:

Positions 2 to 119 are 27.0% ( EScore : 9e-08 ) identical to emb|CAB71968.1| (AJ391256) hypothetical protein [Neisseria meningitidis] >7380510|emb|CAB85096.1| between positions 4 and 125 in [Neisseria meningitidis]
Blast server returned no hits better than 1e-10


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1519 is paralogously related to HD0108 (5e-31).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MDQQWLKATLGKGVAMLLILRLKNSPPEDSISATLETWLRVLTYKKHYEQ
ELDQWRFEEAFMYLAQTCDWFPNPKQLLDAMPKRKIKELPPPPPKTVEQE
EAERLKALSNLQKIKAMLRGCYAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCAACAATGGTTGAAAGCAACATTGGGTAAAGGAGTTGCAATGTT
GCTGATATTACGTTTAAAAAACTCTCCTCCCGAAGATTCAATTAGTGCAA
CTTTAGAAACGTGGTTACGTGTGCTTACTTATAAAAAGCACTATGAGCAA
GAACTCGACCAATGGCGATTTGAAGAGGCATTTATGTATTTAGCACAAAC
TTGTGATTGGTTTCCTAATCCCAAACAGTTACTTGATGCAATGCCTAAAC
GCAAGATTAAAGAACTACCGCCACCACCGCCAAAAACAGTGGAACAAGAA
GAAGCTGAAAGGCTAAAGGCATTGAGCAATTTACAGAAAATTAAAGCAAT
GTTAAGGGGATGTTATGCGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy