Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1112 IGR1113 IGR1111 IGR1110 glmU, - HD1511 pmm,pgm, - HD1507 acrB, - HD1512 HD1505 HD1508 glmU, - HD1511 pmm,pgm, - HD1507 acrB, - HD1512 HD1505 HD1508 Type: tandem, Name:  - 16 glmU, - HD1511 pmm,pgm, - HD1507 acrB, - HD1512 HD1505 HD1509 HD1508 HD1509
* Calculated from Protein Sequence

Gene ID: HD1507

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pmm  pgm  

Definition:
phosphomannomutase/phosphoglucomutase

Gene Start:
1252507

Gene Stop:
1250846

Gene Length:
1662

Molecular Weight*:
60366

pI*:
6.90

Net Charge*:
-0.70

EC:
5.4.2.8  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Energy metabolism; Sugars  

Pathway: pathway table
Fructose and mannose metabolism

Primary Evidence:
Ward CK, Lumbley SR, Latimer JL, Cope LD, Hansen EJ:
Haemophilus ducreyi secretes a filamentous hemagglutinin-like protein.
J Bacteriol 1998 Nov;180(22):6013-22
Medline: 99030326

Secondary Evidence:
Regni C, Tipton PA, Beamer LJ.
Crystal structure of PMM/PGM: an enzyme in the biosynthetic pathway of P. aeruginosa virulence factors.
Structure (Camb). 2002 Feb;10(2):269-79.
PMID: 11839312

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 3929019 and 7467550 in GenBank.

Residues 111 to 553 are 100% ( EScore : 0.0 ) identical to pir||T31101 probable phosphomannomutase - Haemophilus ducreyi between residues 1 and 443 in [Haemophilus ducreyi]
Residues 66 to 553 are 76% ( EScore : 0.0 ) identical to sp|Q57290|Y740_HAEIN PROBABLE PHOSPHOMANNOMUTASE between residues 1 and 485 in [Haemophilus influenzae Rd]
Residues 9 to 539 are 37% ( EScore : 3e-88 ) identical to pir||S73037 probable phosphomannomutase between residues 4 and 528 in [Mycobacterium leprae]
Residues 9 to 537 are 38% ( EScore : 2e-86 ) identical to pir||C70842 probable pmmB protein - Mycobacterium tuberculosis between residues 4 and 525 in [Mycobacterium tuberculosis]
Residues 11 to 550 are 34% ( EScore : 3e-77 ) identical to ref|NP_060760.1|| hypothetical protein FLJ10983 >7023366|dbj|BAA91938.1| between residues 22 and 606 in [Homo sapiens]
Residues 17 to 539 are 34% ( EScore : 1e-75 ) identical to sp|P18159|YHXB_BACSU PROBABLE PHOSPHOMANNOMUTASE between residues 17 and 552 in [Bacillus subtilis]
Residues 11 to 549 are 32% ( EScore : 3e-73 ) identical to pir||T26843 between residues 15 and 590
Residues 46 to 539 are 33% ( EScore : 2e-72 ) identical to emb|CAB96418.1| (AJ243290) phosphoglucomutase between residues 36 and 566 in [Streptococcus thermophilus]
Residues 46 to 544 are 32% ( EScore : 6e-71 ) identical to gb|AAD56627.1|AF165218_2 Pgm between residues 36 and 572 in [Streptococcus pneumoniae]
Residues 7 to 531 are 33% ( EScore : 4e-70 ) identical to pir||T41173 phosphomannomutase homolog - fission yeast between residues 8 and 565 in [Schizosaccharomyces pombe]

COGS Summary:  COGS Search
BeTs to 17 clades of COG1109
COG name: Phosphomannomutase
Functional Class: G
The phylogenetic pattern of COG1109 is aMTKYQVCEBRHUJgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001485 (Phosphoglucomutase and phosphomannomutase family) with a combined E-value of 6.1e-06.
    IPB001485    145-154


ProDom Summary:  Protein Domain Search
Residues 85-167 are 91% similar to a (PHOSPHOMANNOMUTASE PHOSPHOGLUCOMUTASE ISOMERASE COMPLETE) protein domain (PD000667) which is seen in Y740_HAEIN.

Residues 485-551 are 71% similar to a (PHOSPHOMANNOMUTASE PROTEOME COMPLETE) protein domain (PD006924) which is seen in Q9CLX5_PASMU.

Residues 294-411 are 46% similar to a (PHOSPHOMANNOMUTASE PHOSPHORYLATION) protein domain (PD358212) which is seen in Q9NV22_HUMAN.

Residues 227-282 are 55% similar to a (COMPLETE PROTEOME PHOSPHOMANNOMUTASE) protein domain (PD343822) which is seen in Q9KKR1_VIBCH.

Residues 228-289 are 52% similar to a (PMMLP 4931406N15RIK PHOSPHOMANNOMUTASES) protein domain (PD235454) which is seen in Q9V761_DROME.

Residues 415-484 are 72% similar to a (PROTEOME PHOSPHOMANNOMUTASE) protein domain (PD413187) which is seen in Q9CLX5_PASMU.

Residues 280-414 are 85% similar to a (PHOSPHOGLUCOMUTASE COMPLETE PROTEOME ISOMERASE) protein domain (PD344757) which is seen in Q9CLX5_PASMU.

Residues 10-71 are 74% similar to a (PROTEOME COMPLETE PHOSPHOMANNOMUTASE) protein domain (PD346888) which is seen in Q9CLX5_PASMU.

Residues 168-279 are 71% similar to a (PHOSPHORYLATION PHOSPHOMANNOMUTASE) protein domain (PD241121) which is seen in Q9CLX5_PASMU.



Paralogs:  Local Blast Search
HD1507 is paralogously related to HD0201 (2e-12).


Pfam Summary:  Pfam Search
Residues 49 to 192 (E-value = 2.4e-49) place HD1507 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)
Residues 211 to 318 (E-value = 5.4e-05) place HD1507 in the PGM_PMM_II family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II (PF02879)

PDB Hit:
pdb|3PMG|A Chain A, Phosphoglucomutase Mol_id: 1; Molecule: Alp... 69 2e-012
pdb|1JDY|A Chain A, Rabbit Muscle Phosphoglucomutase >gi|194219... 67 5e-012

Gene Protein Sequence:
MTTIFTIAQHWLAQDPDLETQNELSHLIDNAKAGGKQALKELTARFGGRL
QFGTAGLRGPLQAGPMGMNRVLVAQAAAGLALYLKTYDKQPSIVIGYDGR
KNSDVFARDTAEIMAGVGIKAYLLPRKLPTPVLAYAIKHLDTTAGVMVTA
SHNPPEDNGYKVYLGKANGGGQIVSPADQQIAAFIDQVATGNIRELARSQ
DFNLLDDEVINAYIEKTARLSQENKMALNYVYTAMHGVGYEVLQKTLKQA
GLSQPKLVSEQIEPDGNFPTVSFPNPEEKGALDLAIKLAQQENAEFIIAN
DPDADRLAVAIPDAQGIWKSLHGNVLGCLLGWHLAKKYHAQGQQGVLACS
LVSSPALAEIAKKYGLKSEETLTGFKYIGKVDNLLFGFEEAIGYLVDPDK
VRDKDGISAAVAFLDLVLYLKKQGKTILDYINEFNQQFGAYISGQISIRV
SDLAEISKLMTALRNNPPTKIGGVKVTQLIDHTKTDRQSDILVFNLANGS
RLITRPSGTEPKIKFYLDVKGNNGQQEAERALAHFDESVRQMLRQTQYGN
QDC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTACCATTTTTACCATTGCTCAACATTGGTTAGCACAAGATCCAGA
TCTAGAAACTCAAAACGAATTATCCCATTTAATAGATAACGCAAAAGCGG
GTGGTAAACAAGCCTTAAAAGAATTAACCGCGCGTTTTGGAGGACGCTTG
CAATTTGGTACAGCAGGATTACGTGGCCCTTTACAAGCAGGACCAATGGG
AATGAACCGAGTATTAGTGGCACAAGCGGCAGCCGGCTTAGCACTATATC
TCAAAACCTATGATAAACAGCCATCAATTGTTATTGGATATGACGGGCGC
AAAAATTCAGATGTTTTTGCCCGCGATACTGCAGAAATTATGGCTGGAGT
GGGTATTAAAGCTTATTTATTGCCACGCAAATTACCAACACCCGTCTTAG
CTTACGCAATTAAACATCTTGACACCACCGCAGGCGTAATGGTTACAGCA
AGCCATAACCCGCCAGAAGATAATGGTTATAAAGTTTACTTAGGCAAAGC
AAATGGCGGTGGACAAATTGTTTCGCCAGCCGACCAACAAATTGCCGCAT
TCATTGATCAAGTCGCAACGGGCAACATCCGTGAATTAGCACGCAGTCAA
GACTTCAACTTACTAGATGACGAAGTAATAAATGCATATATCGAAAAAAC
GGCCCGCTTAAGCCAAGAGAACAAAATGGCTCTCAACTATGTTTATACGG
CAATGCACGGCGTAGGGTATGAAGTATTACAGAAAACACTCAAACAAGCG
GGTTTATCTCAACCCAAATTAGTCAGCGAACAAATTGAGCCGGATGGCAA
TTTTCCCACCGTCAGCTTCCCAAACCCAGAAGAAAAAGGCGCACTAGATT
TAGCCATCAAATTAGCACAACAAGAAAACGCAGAATTTATTATTGCCAAC
GATCCAGACGCAGACCGTTTAGCTGTTGCTATTCCTGATGCACAAGGAAT
CTGGAAAAGTTTGCACGGCAATGTATTAGGTTGCTTATTAGGATGGCATT
TAGCCAAAAAATACCACGCACAAGGTCAACAAGGCGTATTAGCTTGCTCC
TTAGTTTCTTCTCCCGCACTTGCTGAAATTGCCAAAAAATATGGCCTAAA
ATCAGAAGAAACGCTGACCGGCTTTAAATATATTGGGAAAGTTGATAACT
TATTGTTTGGTTTTGAAGAAGCGATAGGTTATTTAGTCGACCCGGACAAA
GTCCGTGATAAAGACGGCATCTCAGCCGCTGTAGCTTTCTTGGATCTTGT
ACTTTACTTAAAAAAACAAGGCAAAACTATTTTAGATTATATTAATGAAT
TTAACCAACAATTTGGCGCCTATATAAGTGGACAAATTTCTATTCGTGTT
AGCGATTTGGCGGAAATTAGCAAATTAATGACCGCTTTACGTAATAATCC
ACCCACTAAAATTGGTGGCGTAAAGGTTACTCAATTAATTGACCACACCA
AAACAGACCGCCAAAGTGATATTTTGGTATTCAACTTAGCAAATGGTAGC
CGTTTAATTACTAGACCATCTGGCACTGAACCCAAAATTAAGTTTTACTT
AGATGTAAAAGGCAACAATGGACAACAAGAAGCAGAAAGAGCCCTTGCCC
ACTTTGATGAAAGCGTCCGCCAAATGTTACGTCAAACACAATATGGCAAC
CAAGATTGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy