Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1107 IGR1105 IGR1108 IGR1106 IGR1109 HD1502 ftsJ,rrmJ, - HD1501 ftsH, - HD1500 HD1505 guaB,impDH, - HD1503 guaA, - HD1504 HD1502 ftsJ,rrmJ, - HD1501 ftsH, - HD1500 HD1505 guaB,impDH, - HD1503 guaA, - HD1504 HD1502 ftsJ,rrmJ, - HD1501 ftsH, - HD1500 HD1505 guaB,impDH, - HD1503 guaA, - HD1504
* Calculated from Protein Sequence

Gene ID: HD1504

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
guaA  

Definition:
GMP synthase

Gene Start:
1236021

Gene Stop:
1237592

Gene Length:
1572

Molecular Weight*:
58273

pI*:
6.40

Net Charge*:
-5.67

EC:
6.3.5.2  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Purine metabolism

Primary Evidence:
Ward,C.K., Lumbley,S.R., Latimer,J.L., Cope,L.D. and Hansen,E.J.
Haemophilus ducreyi secretes a filamentous hemagglutinin-like
protein
J. Bacteriol. 180 (22), 6013-6022 (1998)
MEDLINE: 99030326


Secondary Evidence:
Maskell,D.
Cloning and sequencing of the Haemophilus influenzae aroA gene
Gene 129 (1), 155-156 (1993)
MEDLINE: 93328119

Grimaldi C, Dutertre M, Simonet JM.
Genetic organization and polymorphism of the guaA gene encoding the GMP synthetase in Lactobacillus rhamnosus.
Curr Microbiol. 2000 Apr;40(4):245-9.
PMID: 10688693

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 3929020 and 7467549 in GenBank.

Many hits to guaA are observed, e.g. residues 1-523 are 89% similar to GuaA from P.multocida (15602158)and 86% similar to GUAA_HAEIN (16272185).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0519
COG name: GMP synthase - PP-ATPase domain
Functional Class:  F
The phylogenetic pattern of COG0519 is amtkyqvcebrhuj--o--n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001674 (GMP synthase C terminal domain) with a combined E-value of 3e-241.
    IPB001674A    9-35
    IPB001674B    80-89
    IPB001674C    137-149
    IPB001674D    174-195
    IPB001674E    227-267
    IPB001674F    286-318
    IPB001674G    329-342
    IPB001674H    358-412
    IPB001674I    444-483
    IPB001674J    487-523
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 2.6e-13.
    IPB000991A    80-89
    IPB000991B    173-183
***** IPB003694 (NAD+ synthase) with a combined E-value of 5.3e-09.
    IPB003694A    229-248


ProDom Summary:  Protein Domain Search
Residues 226-313 are 90% similar to a (GMP BIOSYNTHESIS AMIDOTRANSFERASE) protein domain (PD034321) which is seen in Q9CNX8_PASMU.

Residues 165-201 are 67% similar to a (GLUTAMINE SYNTHASE AMIDOTRANSFERASE BIOSYNTHESIS GMP) protein domain (PD348302) which is seen in GUAA_PSEAE.

Residues 163-225 are 39% similar to a (GMP AMIDOTRANSFERASE GLUTAMINE) protein domain (PD253514) which is seen in GUAA_LACRH.

Residues 52-164 are 83% similar to a (GMP GLUTAMINE AMIDOTRANSFERASE) protein domain (PD004928) which is seen in Q9CNX8_PASMU.

Residues 1-50 are 92% similar to a (GMP AMIDOTRANSFERASE GLUTAMINE) protein domain (PD408681) which is seen in Q9CNX8_PASMU.

Residues 314-523 are 94% similar to a (GMP BIOSYNTHESIS AMIDOTRANSFERASE) protein domain (PD003340) which is seen in Q9CNX8_PASMU.



Paralogs:  Local Blast Search
HD1504 is paralogously related to HD0406 (4e-07) and HD0235 (0.001).


Pfam Summary:  Pfam Search
Residues 10 to 199 (E-value = 9.4e-48) place HD1504 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)
Residues 403 to 522 (E-value = 7.4e-70) place HD1504 in the GMP_synt_C family which is described as GMP synthase C terminal domain (PF00958)

PDB Hit:
pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed W... 849 0.0

Gene Protein Sequence:
MNNIHNHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEKQIREFNP
TGIILSGGPESTTETNSPHAPEYVFKAGVPVLGICYGMQTMAMQLGGLTE
ASEQREFGYAAVELQHADQLFAKLNDDLTASQPKLDVWMSHGDKVTRLPA
GFQTTAVTPTCPIAAMSDEKRRFYGVQFHPEVTHTKSGLALLTNFVENIC
GCARSWTPENIIEDAVAKIKQKVGNDQVILGLSGGVDSSVTALLLHRAIG
KNLHCVFVDNGLLRLNEGDQVMEMFGDKFGLNIIRVNAEERFLEALKGID
EPEAKRKIIGKVFIDIFDDEAKKLTDVKWLAQGTIYPDVIESAASKTGKA
HVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLTLGLPAEMLNRHP
FPGPGLGVRVLGEIKKEYCDLLRNADAIFIEELYKSGWYYKVSQAFTVFL
PVKSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYELLGKISNRIIN
EVNGISRVVYDVSGKPPATIEWE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAACATTCACAATCATAAAATCCTAATTTTAGATTTCGGTTCACA
ATACACGCAATTAATTGCACGTCGCATACGTGAAATTGGAGTCTACTGTG
AACTTTGGGCATGGGACGTAACAGAAAAACAGATCCGTGAATTTAACCCA
ACCGGCATCATTCTTTCGGGCGGCCCTGAAAGTACCACCGAAACTAATAG
CCCGCATGCACCTGAATATGTCTTTAAGGCAGGCGTACCCGTATTAGGCA
TCTGCTATGGTATGCAAACTATGGCAATGCAATTAGGCGGTTTAACCGAA
GCTTCTGAACAGCGCGAATTTGGCTATGCCGCTGTTGAATTACAACATGC
AGATCAATTATTCGCAAAATTAAATGATGATTTAACCGCTTCACAACCTA
AATTAGATGTTTGGATGAGCCATGGCGATAAAGTCACACGCCTACCTGCA
GGCTTTCAAACTACTGCAGTAACTCCAACTTGCCCTATTGCAGCTATGTC
TGATGAAAAACGACGTTTCTACGGCGTACAATTCCACCCTGAAGTCACAC
ACACGAAAAGTGGTTTAGCATTGCTGACTAATTTTGTAGAAAATATTTGT
GGTTGTGCACGTAGCTGGACACCTGAAAATATTATTGAAGATGCCGTTGC
TAAAATTAAACAAAAAGTAGGCAATGACCAAGTTATTTTAGGACTATCCG
GTGGCGTAGACTCATCAGTCACTGCCCTATTATTACACCGCGCAATCGGT
AAAAATTTACATTGCGTATTTGTCGATAACGGCTTGCTCCGCTTAAATGA
AGGCGATCAAGTAATGGAAATGTTTGGCGATAAATTTGGCTTAAACATCA
TTCGCGTTAACGCGGAAGAACGCTTCTTAGAAGCGCTTAAAGGTATTGAT
GAACCAGAAGCAAAACGAAAAATTATTGGTAAAGTATTTATTGATATATT
TGATGATGAAGCCAAAAAACTCACTGACGTAAAATGGTTAGCACAAGGCA
CGATCTACCCTGATGTCATTGAATCAGCAGCAAGCAAAACAGGCAAAGCA
CACGTGATCAAATCACATCATAACGTAGGTGGCTTACCAGACTACATGAA
GCTTGGCTTAGTCGAACCATTACGTGAGCTTTTTAAAGATGAAGTACGTA
AAATTGGCCTCACATTAGGCCTGCCTGCTGAAATGCTCAATCGCCACCCT
TTCCCAGGCCCCGGTTTAGGCGTACGTGTACTAGGTGAAATCAAAAAAGA
ATACTGCGATTTATTACGCAATGCAGATGCCATTTTTATTGAAGAACTTT
ATAAATCAGGCTGGTATTACAAAGTGAGCCAAGCATTTACCGTCTTCTTA
CCCGTGAAATCTGTAGGCGTAATGGGCGATGGACGCAAATACGACTGGGT
CGTATCTCTACGTGCGGTAGAAACCATTGATTTTATGACCGCTCATTGGG
CACATTTACCCTATGAATTACTAGGTAAAATCTCAAACCGCATCATCAAC
GAAGTAAATGGCATTTCTCGCGTCGTATATGACGTGTCAGGCAAACCTCC
TGCGACTATTGAGTGGGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy