Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1107 IGR1105 IGR1108 IGR1106 IGR1104 IGR1109 HD1502 ftsJ,rrmJ, - HD1501 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 HD1505 guaB,impDH, - HD1503 guaA, - HD1504 HD1502 ftsJ,rrmJ, - HD1501 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 HD1505 guaB,impDH, - HD1503 guaA, - HD1504 HD1502 ftsJ,rrmJ, - HD1501 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 HD1505 guaB,impDH, - HD1503 guaA, - HD1504
* Calculated from Protein Sequence

Gene ID: HD1503

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
guaB  impDH  

Definition:
inosine 5' monophosphate dehydrogenase

Gene Start:
1234408

Gene Stop:
1235871

Gene Length:
1464

Molecular Weight*:
52365

pI*:
7.10

Net Charge*:
0.50

EC:
1.1.1.205  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Fujio T, Nishi T, Ito S, Maruyama A.
High level expression of XMP aminase in Escherichia coli and its application for the industrial production of 5'-guanylic acid.
Biosci Biotechnol Biochem. 1997 May;61(5):840-5.
PMID: 9178561

Tesfa-Selase F, Drabble WT.
Specific binding of DnaA protein to a DnaA box in the guaB gene of Escherichia coli K12.
Eur J Biochem. 1996 Oct 15;241(2):411-6.
PMID: 8917437

Comment:
0

Blast Summary:  PSI-Blast Search
There are many strong hits to impdH, e.g. residues 2-487 are 91% similar to >16272183 from H.influenzae. Residues 1-487 are 89% similar to the enzyme from P.multocida (15602160).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0516
COG name: IMP dehydrogenase/GMP reductase
Functional Class:  F
The phylogenetic pattern of COG0516 is -MTKYQVcEBRHUJ--O--n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001093 (IMP dehydrogenase / GMP reductase) with a combined E-value of 6.7e-105.
    IPB001093A    9-18
    IPB001093B    35-77
    IPB001093C    290-321
    IPB001093D    334-373
    IPB001093E    396-405
    IPB001093F    412-423
    IPB001093B    215-257
***** IPB000262 (FMN-dependent alpha-hydroxy acid dehydrogenases) with a combined E-value of 1.1e-06.
    IPB000262F    331-383
***** IPB001295 (Dihydroorotate dehydrogenase) with a combined E-value of 5.6e-06.
    IPB001295H    333-363
    IPB001295H    270-300


ProDom Summary:  Protein Domain Search
Residues 271-361 are 76% similar to a (DEHYDROGENASE OXIDASE OXIDOREDUCTASE BIOSYNTHESIS FMN) protein domain (PD000662) which is seen in IMDH_PASMU.

Residues 261-317 are 49% similar to a (DEHYDROGENASE BIOSYNTHESIS OXIDOREDUCTASE GMP) protein domain (PD304134) which is seen in IMDH_AQUAE.

Residues 365-477 are 93% similar to a (DEHYDROGENASE BIOSYNTHESIS) protein domain (PD001792) which is seen in IMDH_PASMU.

Residues 333-485 are 32% similar to a (DEHYDROGENASE BIOSYNTHESIS DOMAIN) protein domain (PD044384) which is seen in IMDH_TRIFO.

Residues 206-259 are 81% similar to a (DEHYDROGENASE BIOSYNTHESIS INOSINE-5'-MONOPHOSPHATE IMP) protein domain (PD329452) which is seen in IMDH_PASMU.

Residues 319-363 are 68% similar to a (DEHYDROGENASE BIOSYNTHESIS OXIDOREDUCTASE GMP IMP) protein domain (PD394519) which is seen in Q9PKM2_CHLMU.

Residues 152-205 are 79% similar to a (DEHYDROGENASE BIOSYNTHESIS) protein domain (PD338945) which is seen in IMDH_HAEIN.

Residues 6-89 are 97% similar to a (DEHYDROGENASE BIOSYNTHESIS INOSINE-5'-MONOPHOSPHATE) protein domain (PD002050) which is seen in IMDH_PASMU.

Residues 97-138 are 85% similar to a (COMPLETE PROTEOME DEHYDROGENASE DOMAIN) protein domain (PD000251) which is seen in IMDH_HAEIN.



Paralogs:  Local Blast Search
HD1503 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 473 (E-value = 3.4e-204) place HD1503 in the IMPDH family which is described as IMP dehydrogenase / GMP reductase domain (PF00478)
Residues 91 to 144 (E-value = 1.4e-12) place HD1503 in the CBS family which is described as CBS domain (PF00571)
Residues 153 to 206 (E-value = 7.1e-11) place HD1503 in the CBS family which is described as CBS domain (PF00571)

PDB Hit:
pdb|1ZFJ|A Chain A, Inosine Monophosphate Dehydrogenase (Impdh;... 481 7e-137
pdb|1EEP|B Chain B, 2.4 A Resolution Crystal Structure Of Borre... 288 1e-078
pdb|1B3O|B Chain B, Ternary Complex Of Human Type-Ii Inosine Mo... 283 3e-077

Gene Protein Sequence:
MLRIKQEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMD
TVTETKLAISLAQEGGIGFIHKNMSIERQADRVRKVKKFESGIVSEPVTV
SPELTLAELAQLVKKNGFAGYPVVDNENNLVGIITGRDTRFVQDLTQTVS
KVMTHRDRLVTVKENAKREEILALMHEHRVEKVLMVDDAFKLKGMITVKD
FQKAEQKPNACKDEFGRLRVGAAVGAGPGNEERIDALVKAGIDVLLIDSS
HGHSEGVLQRVRETRAKYPDLPIVAGNVATAEGAIALADAGASAVKVGIG
PGSICTTRIVTGVGVPQITAIAEAAEALKDRDIPIIADGGIRYFGDISKA
IAAGASCVMVGSMFAGTEEAPGEIELYQGRVFKSYRGMGSLGAMSKGSSD
RYFQSDNAADKLVPEGIEGRIPYKGYLKEIIHQQMGDLRSCMGLTGSATI
EDLRTKAQFVRISGAGIKESHVHDVTITKEAPNYHMG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACGCATCAAACAAGAAGCCCTCACATTTGATGATGTTTTACTCGT
CCCAGCACACTCTACAGTGCTTCCAAATACTGCCGACCTTTCTACTCAAC
TAACAAAAACAATCCGTTTAAATATTCCAATGCTATCCGCAGCGATGGAT
ACTGTTACTGAAACCAAATTAGCGATTTCATTAGCACAAGAAGGTGGCAT
TGGGTTTATTCACAAAAATATGTCGATTGAACGCCAAGCTGATCGTGTTC
GTAAAGTGAAAAAATTTGAAAGCGGTATCGTTTCTGAACCTGTTACCGTG
TCACCCGAATTAACATTAGCTGAATTAGCACAACTTGTGAAGAAAAATGG
CTTTGCGGGCTATCCGGTCGTAGATAATGAAAATAATCTTGTCGGGATTA
TTACCGGACGCGATACCCGCTTTGTACAAGACCTAACCCAAACGGTTTCT
AAAGTAATGACACATCGTGACCGCTTAGTTACAGTCAAAGAAAATGCCAA
ACGCGAAGAAATTTTAGCCTTAATGCATGAACATCGGGTAGAAAAAGTAC
TAATGGTTGATGATGCATTTAAATTAAAAGGTATGATCACCGTAAAAGAC
TTCCAAAAAGCAGAACAAAAACCCAATGCTTGTAAAGATGAATTTGGTCG
ATTACGCGTGGGTGCAGCAGTAGGCGCGGGGCCGGGTAATGAAGAACGTA
TAGACGCCCTAGTTAAAGCCGGTATAGATGTATTATTAATTGATTCATCA
CACGGACATTCAGAAGGTGTATTACAACGTGTACGTGAGACACGTGCCAA
ATACCCGGATCTTCCTATTGTGGCTGGTAATGTTGCGACTGCTGAAGGCG
CAATTGCTTTAGCTGATGCCGGTGCAAGCGCGGTAAAAGTGGGTATCGGC
CCGGGTTCAATTTGTACTACACGAATTGTAACGGGCGTGGGCGTTCCGCA
AATTACTGCAATTGCTGAAGCGGCTGAAGCGTTAAAAGATCGTGATATCC
CGATTATTGCTGACGGAGGTATCCGTTATTTTGGCGATATTTCAAAAGCT
ATTGCAGCAGGCGCAAGCTGTGTAATGGTTGGCTCAATGTTTGCGGGTAC
AGAAGAAGCGCCCGGTGAAATTGAACTGTATCAAGGCCGAGTATTTAAAT
CTTATCGAGGCATGGGCTCATTAGGCGCAATGTCTAAAGGTTCATCAGAT
CGCTATTTCCAATCAGATAATGCAGCCGATAAACTTGTGCCAGAAGGTAT
TGAAGGACGTATTCCTTACAAAGGTTATTTAAAAGAAATTATCCATCAAC
AAATGGGTGACTTGCGTTCTTGTATGGGCTTAACTGGATCTGCAACTATT
GAAGATTTACGCACTAAAGCACAATTCGTACGAATAAGCGGTGCGGGAAT
CAAAGAATCCCATGTTCACGACGTTACTATTACCAAAGAAGCCCCTAACT
ACCATATGGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy