Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1100 IGR1098 IGR1105 IGR1102 IGR1103 IGR1099 IGR1104 IGR1101 rpS9, - HD1493 rplM, - HD1494 HD1492 HD1489 ftsJ,rrmJ, - HD1501 HD1487 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 glnD, - HD1497 HD1495 rpS9, - HD1493 rplM, - HD1494 HD1492 HD1489 ftsJ,rrmJ, - HD1501 HD1487 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 glnD, - HD1497 HD1495 rpS9, - HD1493 rplM, - HD1494 ftsJ,rrmJ, - HD1501 HD1487 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 glnD, - HD1497 HD1491 glnD, - HD1496 glnD, - HD1496 HD1492 HD1489 HD1491 HD1495
* Calculated from Protein Sequence

Gene ID: HD1497

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glnD  

Definition:
uridylyltransferase

Gene Start:
1230058

Gene Stop:
1228124

Gene Length:
1935

Molecular Weight*:
75304

pI*:
7.80

Net Charge*:
7.05

EC:
2.7.7.59  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table

Secondary Evidence:
Hesketh A, Fink D, Gust B, Rexer HU, Scheel B, Chater K, Wohlleben W, Engels A.
The GlnD and GlnK homologues of Streptomyces coelicolor A3(2) are functionally dissimilar to their nitrogen
regulatory system counterparts from enteric bacteria.
Mol Microbiol. 2002 Oct;46(2):319-330.
PMID: 12406211

Perlova O, Nawroth R, Zellermann E, Meletzus D.
Isolation and characterization of the glnD gene of Gluconacetobacter diazotrophicus, encoding a putative
uridylyltransferase/uridylyl-removing enzyme.
Gene. 2002 Sep 4;297(1-2):159.
PMID: 12384297

Kim IH, Kwak SJ, Kang J, Park SC.
Transcriptional control of the glnD gene is not dependent on nitrogen availability in Escherichia coli.
Mol Cells. 1998 Aug 31;8(4):483-90.
PMID: 9749538

Comment:
From Genbank:[gi:21362567]
This protein modifies, by uridylylation or deuridylylation the PII
(glnB) regulatory protein.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to uridylyltransferases. Residues 20-637 are 48% similar to this enzyme from Haemophilus influenzae (1169938|) and residues 2-637 are 45% similar to this enzyme from Pasteurella multocida (22256767).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 526-606 are 55% similar to a (TRANSFERASE URIDYLYL REMOVING UTASE) protein domain (PD380102) which is seen in GLND_HAEIN.

Residues 209-278 are 54% similar to a (TRANSFERASE URIDYLYL- REMOVING UTASE) protein domain (PD404321) which is seen in GLND_HAEIN.

Residues 56-278 are 54% similar to a (TRANSFERASE URIDYLYL REMOVING UTASE) protein domain (PD010199) which is seen in GLND_VIBFI.

Residues 403-506 are 64% similar to a (TRANSFERASE NUCLEOTIDYLTRANSFERASE ENZYME) protein domain (PD014387) which is seen in GLND_HAEIN.

Residues 280-398 are 34% similar to a (TRANSFERASE URIDYLYL REMOVING UTASE) protein domain (PD216991) which is seen in GLND_HAEIN.



Paralogs:  Local Blast Search
HD1497 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 36 to 137 (E-value = 1.3e-06) place HD1497 in the NTP_transf_2 family which is described as Nucleotidyltransferase domain (PF01909)
Residues 435 to 569 (E-value = 6.4e-09) place HD1497 in the HD family which is described as HD domain (PF01966)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MILSFKTEILAFNQQQKTAFTTDNVTKLLHQRSDYYDQLLNSLWQQFGFA
ERYDLALIAVGGYGRREMFPLSDLDILVLSQHPVDEISRARLNELFNILW
DSKLQVGASIRSIAQCIEIGQQELSVATNMYEGRLLTGNKQLWHSLIEKL
YAEDFWPIETFFKAKMEERAERYSRYHNTGYNLEPDIKHSPGGLRDLHLI
YWISMRQFGTFSLDTLLNKGILFAEEYRELSAAQAVLFKMRFALHLQLKR
YDNRLYFDRQLCLSKQLGYQGEGNQPVETMMRHYFQATQSISQLSQLLLD
NFQLSDRNPHHLAEKQALDNYFYLQGHQLNCQNRRCFTQQPSTILDLFYY
LTEYPNVKINAKTLRYLRLALQKLTEPLCQNPTARKRFIALFSQPNVIAR
AIVPMHQLGVLSAYLPQWQAIVGLMQFDLFHLYTVDEHTIRVMQKLESFL
APQTAEDYPLCCQLFQQSDHKPILYLVALFHDIAKGRKGEHTNLGAEEIY
QFALLHDFSAQQAQQMAWLVQQHLTMSITAQRRDIHDSSVVQHFAKIVRN
STALADLMCLTIADICATNANLWNDWKRTLFSQLYQFTLKELDRSLDYQC
VSQAHRAEAFALLNARLSIMEQQKLHAFWQPCPKVIFYVTRRFN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCCTTTCCTTTAAAACCGAAATTCTTGCCTTTAATCAGCAACAAAA
AACCGCTTTTACTACTGATAACGTTACTAAATTATTGCATCAACGAAGTG
ATTATTACGATCAATTATTAAATTCATTATGGCAACAATTTGGTTTCGCA
GAACGTTATGATCTTGCATTAATTGCGGTGGGGGGCTATGGTCGGCGAGA
AATGTTCCCATTGTCTGATTTAGATATTTTAGTGTTATCACAACACCCCG
TAGATGAAATCAGTCGTGCTAGATTAAATGAATTATTTAATATTTTATGG
GATAGTAAATTACAAGTCGGAGCGAGTATTCGTTCAATCGCGCAGTGTAT
TGAAATTGGCCAACAGGAATTATCCGTTGCGACCAATATGTACGAAGGGC
GTTTACTGACAGGCAATAAGCAGTTATGGCATAGCTTAATTGAAAAGTTA
TATGCGGAAGATTTTTGGCCTATAGAAACGTTTTTTAAAGCAAAAATGGA
AGAGCGTGCTGAACGTTATAGCCGCTATCATAATACTGGCTATAATTTAG
AACCGGATATAAAACATAGCCCCGGTGGTTTACGTGATCTACATTTAATT
TATTGGATCTCAATGCGACAATTTGGCACCTTTTCACTGGATACGCTACT
CAATAAAGGGATTTTATTTGCTGAAGAATACCGCGAATTAAGCGCGGCAC
AAGCGGTACTGTTTAAAATGCGTTTTGCCTTACACTTACAGCTTAAACGT
TATGACAACCGCTTATATTTTGATCGCCAGCTCTGTTTAAGCAAACAATT
AGGTTATCAAGGAGAAGGTAATCAGCCGGTTGAAACAATGATGCGTCATT
ATTTTCAAGCGACACAATCGATTTCTCAATTAAGCCAATTATTACTAGAT
AATTTTCAATTATCGGATCGTAATCCGCATCATTTAGCTGAAAAACAAGC
GCTTGATAATTATTTTTATCTACAAGGCCATCAACTCAACTGCCAAAATC
GTCGTTGTTTTACACAACAGCCTAGTACTATTCTAGATCTGTTTTATTAT
CTCACTGAATATCCTAACGTAAAAATTAATGCTAAAACATTGCGATATTT
ACGGCTTGCATTGCAAAAACTCACGGAACCGTTATGCCAAAATCCAACGG
CACGTAAACGTTTTATCGCGCTTTTTTCACAGCCTAATGTTATTGCCAGA
GCTATTGTACCCATGCATCAATTAGGCGTATTGTCAGCTTATTTGCCCCA
ATGGCAAGCGATTGTTGGCTTGATGCAATTTGATTTATTTCATCTTTATA
CGGTTGATGAACATACCATCAGAGTCATGCAAAAGCTTGAAAGCTTTTTG
GCTCCGCAGACGGCAGAGGATTATCCACTTTGTTGTCAATTGTTTCAGCA
ATCCGATCATAAACCAATACTTTATTTAGTCGCATTATTTCACGATATTG
CCAAAGGCCGAAAGGGTGAACATACGAATTTAGGTGCTGAAGAAATCTAT
CAGTTTGCCTTATTACATGATTTCTCAGCGCAACAAGCACAACAAATGGC
GTGGTTAGTGCAACAGCATTTAACTATGTCGATTACTGCCCAACGGCGTG
ATATTCATGATTCATCTGTTGTCCAACATTTTGCAAAAATTGTAAGAAAT
TCGACCGCTTTAGCGGATTTAATGTGCCTAACAATTGCCGATATTTGTGC
CACAAATGCTAATCTTTGGAATGATTGGAAGCGAACGCTATTTAGTCAGC
TATATCAATTTACCTTGAAAGAATTAGATAGATCCCTAGATTATCAATGT
GTTAGCCAAGCACATCGTGCCGAAGCATTTGCATTGCTTAACGCGCGTTT
ATCAATAATGGAACAACAAAAATTACACGCTTTTTGGCAACCTTGTCCAA
AAGTTATTTTTTACGTAACACGCCGATTCAACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy