Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1100 IGR1098 IGR1102 IGR1103 IGR1099 IGR1104 IGR1101 rpS9, - HD1493 rplM, - HD1494 HD1492 HD1489 HD1487 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 glnD, - HD1497 HD1495 rpS9, - HD1493 rplM, - HD1494 HD1492 HD1489 HD1487 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 glnD, - HD1497 HD1495 rpS9, - HD1493 rplM, - HD1494 HD1487 tyrP,tyrP-B, - HD1499 ftsH, - HD1500 glnD, - HD1497 HD1491 glnD, - HD1496 HD1486 glnD, - HD1496 HD1486 HD1492 HD1489 HD1491 HD1495
* Calculated from Protein Sequence

Gene ID: HD1496

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glnD  

Definition:
uridylyltransferase

Gene Start:
1228175

Gene Stop:
1227504

Gene Length:
672

Molecular Weight*:
25236

pI*:
10.20

Net Charge*:
9.54

EC:
2.7.7.59  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table

Secondary Evidence:
Hesketh A, Fink D, Gust B, Rexer HU, Scheel B, Chater K, Wohlleben W, Engels A.
The GlnD and GlnK homologues of Streptomyces coelicolor A3(2) are functionally dissimilar to their nitrogen regulatory system
counterparts from enteric bacteria.
Mol Microbiol. 2002 Oct;46(2):319-30.
PMID: 12406211

Perlova O, Nawroth R, Zellermann EM, Meletzus D.
Isolation and characterization of the glnD gene of Gluconacetobacter diazotrophicus, encoding a putative
uridylyltransferase/uridylyl-removing enzyme.
Gene. 2002 Sep 4;297(1-2):159-68.
PMID: 12384297

Comment:
From Genbank:[gi:21362567]
This protein modifies, by uridylylation or deuridylylation the PII
(glnB) regulatory protein.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to uridylyltransferases. Residues 6-213 are 48% similar to this enzyme from Pasteurella multocida (22256767|) and residues 6-221 are 41% similar to this enzyme from Haemophilus influenzae (1169938|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 131-210 are 52% similar to a (TRANSFERASE URIDYLYL REMOVING UTASE) protein domain (PD401062) which is seen in Q9CNH1_PASMU.

Residues 46-93 are 52% similar to a (TRANSFERASE REMOVING UTASE PROTEIN-PII) protein domain (PD404036) which is seen in GLND_VIBFI.

Residues 46-96 are 60% similar to a (TRANSFERASE PROTEOME REMOVING UTASE) protein domain (PD412136) which is seen in Q9CNH1_PASMU.

Residues 45-218 are 41% similar to a (TRANSFERASE REMOVING UTASE PROTEIN-PII) protein domain (PD309136) which is seen in GLND_VIBCH.



Paralogs:  Local Blast Search
HD1496 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 45 to 124 (E-value = 1.4e-06) place HD1496 in the ACT family which is described as ACT domain (PF01842)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LATLSKSYFLRNTPIQLVWHAQAFIQKAENEPLVLVSNQYARGATEIFVH
CSDQPQLFAHIAQVLSRKKISIHDAQIMTSKDKKVFDSFIVTEVHGSALT
ENRCREIKRALLEMLLNNKSRTFKLIKKPVKHQSFSANTKVSFLADTQPQ
QTSFELFTLDREGLLAQVSAIFNQLDLVLINAKITTIGERVEDLFVVTTK
QNTALTAQQKKQLKCSLLTELAH$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCAACCTTGTCCAAAAGTTATTTTTTACGTAACACGCCGATTCAACT
AGTTTGGCATGCGCAAGCGTTTATTCAAAAAGCTGAAAATGAACCGCTTG
TGTTAGTCAGCAATCAATATGCGCGTGGTGCTACTGAAATTTTTGTACAT
TGTAGCGACCAACCGCAACTATTCGCGCATATTGCACAAGTTCTTAGCCG
CAAAAAAATTAGCATTCACGATGCACAGATTATGACGAGTAAAGATAAAA
AAGTATTTGATAGTTTTATCGTGACTGAAGTGCATGGATCTGCATTAACC
GAAAATCGTTGTCGTGAAATTAAACGCGCTTTATTAGAAATGCTTTTAAA
TAACAAAAGTAGAACATTTAAATTAATCAAAAAACCGGTGAAACACCAAT
CATTTAGCGCTAATACTAAGGTTTCTTTTTTAGCAGATACACAGCCACAG
CAAACCTCATTTGAATTATTTACATTAGATAGAGAAGGGTTATTAGCTCA
GGTAAGCGCGATCTTTAATCAATTAGATCTAGTGTTAATTAATGCAAAAA
TCACGACTATTGGTGAACGGGTAGAAGATTTATTTGTGGTAACCACCAAA
CAAAATACTGCACTAACAGCGCAACAAAAAAAACAACTTAAATGCAGTTT
ATTAACTGAATTAGCGCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy