Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1094 IGR1100 IGR1098 IGR1093 IGR1097 IGR1095 IGR1099 IGR1092 IGR1096 IGR1101 ihfA, - HD1482 rpS9, - HD1493 rplM, - HD1494 HD1492 HD1489 nlpC, - HD1481 HD1487 pheS, - HD1484 pheT, - HD1483 HD1495 frxA, - HD1485 ihfA, - HD1482 rpS9, - HD1493 rplM, - HD1494 HD1492 HD1489 nlpC, - HD1481 HD1487 pheS, - HD1484 pheT, - HD1483 HD1495 frxA, - HD1485 ihfA, - HD1482 rpS9, - HD1493 rplM, - HD1494 nlpC, - HD1481 HD1487 pheS, - HD1484 pheT, - HD1483 HD1491 HD1486 HD1486 HD1492 HD1489 HD1491 HD1495 frxA, - HD1485
* Calculated from Protein Sequence

Gene ID: HD1485

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
frxA  

Definition:
NAD(P)H nitroreductase/H-flavin oxidoreductase

Gene Start:
1222069

Gene Stop:
1222731

Gene Length:
663

Molecular Weight*:
25276

pI*:
7.80

Net Charge*:
1.78

EC:
1.6.6.-  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Secondary Evidence:
Jeong JY, Mukhopadhyay AK, Dailidiene D, Wang Y, Velapatino B, Gilman RH, Parkinson AJ, Nair GB, Wong BC, Lam SK, Mistry R, Segal I, Yuan Y, Gao H, Alarcon T, Brea ML, Ito Y, Kersulyte D, Lee HK, Gong Y, Goodwin A, Hoffman PS, Berg DE.
Sequential inactivation of rdxA (HP0954) and frxA (HP0642) nitroreductase genes causes moderate and high-level metronidazole resistance in Helicobacter pylori.
J Bacteriol. 2000 Sep;182(18):5082-90.
PMID: 10960091

Kwon DH, Kato M, El-Zaatari FA, Osato MS, Graham DY.
Frame-shift mutations in NAD(P)H flavin oxidoreductase encoding gene (frxA) from metronidazole resistant Helicobacter pylori ATCC43504 and its involvement in metronidazole resistance.
FEMS Microbiol Lett. 2000 Jul 15;188(2):197-202.
PMID: 10913705

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to NAD(P)H-flavin oxidoreductases. Residues 1-219 are 57% similar to this enzyme from Haemophilus influenzae (16273193|) and residues 1-218 are 60% similar to this enzyme from Neisseria meningitidis (15676702|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0778
COG name: Nitroreductase family proteins
Functional Class: C
The phylogenetic pattern of COG0778 is AmT--qVcEBRHUJ-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000415 (Nitroreductase family) with a combined E-value of 8.7e-14.
    IPB000415A    44-56
    IPB000415B    151-169


ProDom Summary:  Protein Domain Search
Residues 135-170 are 86% similar to a (PROTEOME NADPH-FLAVIN COMPLETE) protein domain (PD405302) which is seen in Q9K022_NEIMB.

Residues 10-59 are 74% similar to a (PROTEOME COMPLETE OXIDOREDUCTASE NITROREDUCTASE RDXA) protein domain (PD001645) which is seen in Q9K022_NEIMB.

Residues 133-219 are 75% similar to a (OXIDOREDUCTASE COMPLETE PROTEOME) protein domain (PD036524) which is seen in Q9CMS8_PASMU.

Residues 4-63 are 40% similar to a (OXIDOREDUCTASE NADPH-FLAVIN PROTEOME) protein domain (PD328462) which is seen in O25359_HELPY.

Residues 61-132 are 51% similar to a (OXIDOREDUCTASE PROTEOME NADPH-FLAVIN) protein domain (PD009589) which is seen in YC78_HAEIN.



Paralogs:  Local Blast Search
HD1485 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 199 (E-value = 1e-55) place HD1485 in the Nitroreductase family which is described as Nitroreductase family (PF00881)

PDB Hit:
pdb|1VFR|A Chain A, The Major Nad(P)h:fmn Oxidoreductase From V... 88 8e-019
pdb|1DS7|B Chain B, A Minor Fmn-Dependent Nitroreductase From E... 68 1e-012
pdb|1DS7|A Chain A, A Minor Fmn-Dependent Nitroreductase From E... 68 1e-012

Gene Protein Sequence:
MSEISKQQVLDAFTFRSACRHYDATRKISQQDMQYILELARLSPSSVGSE
PWKFIVLQNPTIRAKIALFSWGIKHPMDEMSHLVIILAKKNARYDSDFFR
ASLTKRGLTAEQLEKTIARYKSFQMNDIKVLENERTLFDWCVKQTYIALA
NMMTGAAMIGIDSCPIEGFNYDAVHQILADEGLFDPNEYGVSCMVTFGYR
AKEMKAKYRKPAEDIISWVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGAAATCTCAAAACAACAAGTATTAGATGCTTTTACTTTTCGTTC
GGCGTGTCGCCATTACGATGCTACGCGTAAAATTAGCCAACAAGATATGC
AATATATTTTAGAACTAGCCCGATTATCGCCAAGCTCAGTTGGTTCAGAA
CCTTGGAAATTTATCGTACTACAGAATCCAACTATACGCGCTAAAATAGC
GCTGTTTAGTTGGGGAATAAAACATCCTATGGACGAAATGAGCCATTTAG
TGATCATTTTAGCTAAAAAAAATGCCCGCTATGATAGTGATTTTTTCCGC
GCATCACTGACTAAAAGAGGCTTAACTGCTGAACAATTAGAAAAAACGAT
TGCCCGTTATAAATCATTCCAAATGAATGATATTAAAGTATTAGAAAATG
AAAGAACATTATTTGATTGGTGTGTCAAACAAACCTATATTGCGCTAGCG
AATATGATGACAGGTGCTGCAATGATTGGCATTGATTCTTGTCCAATCGA
AGGGTTTAATTATGATGCAGTTCATCAAATTCTAGCAGATGAAGGATTAT
TTGATCCAAATGAATATGGCGTTTCGTGTATGGTTACATTTGGGTATCGT
GCCAAAGAAATGAAAGCAAAATATCGCAAACCTGCTGAAGATATTATTAG
TTGGGTTGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy