Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1094 IGR1098 IGR1093 IGR1097 IGR1095 IGR1099 IGR1092 IGR1096 ihfA, - HD1482 rpS9, - HD1493 HD1492 HD1489 nlpC, - HD1481 HD1487 pheS, - HD1484 pheT, - HD1483 frxA, - HD1485 HD1479 ihfA, - HD1482 rpS9, - HD1493 HD1492 HD1489 nlpC, - HD1481 HD1487 pheS, - HD1484 pheT, - HD1483 frxA, - HD1485 HD1479 ihfA, - HD1482 rpS9, - HD1493 nlpC, - HD1481 HD1487 pheS, - HD1484 pheT, - HD1483 HD1491 HD1486 HD1486 HD1492 HD1489 HD1491 frxA, - HD1485 bioD,dtbS, - HD1480 HD1479 bioD,dtbS, - HD1480
* Calculated from Protein Sequence

Gene ID: HD1484

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pheS  

Definition:
phenylalanyl-tRNA synthetase, alpha subunit

Gene Start:
1221811

Gene Stop:
1220828

Gene Length:
984

Molecular Weight*:
37386

pI*:
6.50

Net Charge*:
-2.62

EC:
6.1.1.20  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Fayat,G., Mayaux,J.F., Sacerdot,C., Fromant,M., Springer,M.,
Grunberg-Manago,M. and Blanquet,S.
Escherichia coli phenylalanyl-tRNA synthetase operon region.
Evidence for an attenuation mechanism. Identification of the gene
for the ribosomal protein L20
J. Mol. Biol. 171 (3), 239-261 (1983)
Medline: 84090239

Kast,P. and Hennecke,H.
Amino acid substrate specificity of Escherichia coli
phenylalanyl-tRNA synthetase altered by distinct mutations
J. Mol. Biol. 222 (1), 99-124 (1991)
Medline: 92046090

Kast,P., Wehrli,C. and Hennecke,H.
Impaired affinity for phenylalanine in Escherichia coli phenylalanyl-tRNA synthetase mutant caused by Gly-to-Asp exchange
in motif 2 of class II tRNA synthetases
FEBS Lett. 293 (1-2), 160-163 (1991)
Medline: 92070551

Kast,P., Keller,B. and Hennecke,H.
Identification of the pheS5 mutation, which causes
thermosensitivity of Escherichia coli mutant NP37
J. Bacteriol. 174 (5), 1686-1689 (1992)
Medline: 92165746



Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to phenylalanyl-tRNA synthetase alpha chain. Residues 1-327 are 81% similar to this enzyme from Pasteurella multocida (15602496|) and are 78% similar to this enzyme from Haemophilus influenzae (16273223|).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0016
COG name: Phenylalanyl-tRNA synthetase alpha subunit
Functional Class: J
The phylogenetic pattern of COG0016 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 222-326 are 93% similar to a (SYNTHETASE LIGASE CHAIN ALPHA) protein domain (PD006935) which is seen in SYFA_PASMU.

Residues 1-65 are 60% similar to a (SYNTHETASE ALPHA CHAIN LIGASE) protein domain (PD409709) which is seen in SYFA_PASMU.

Residues 90-220 are 84% similar to a (SYNTHETASE LIGASE ALPHA CHAIN) protein domain (PD002080) which is seen in SYFA_PASMU.



Paralogs:  Local Blast Search


HD1484 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 88 (E-value = 2.6e-33) place HD1484 in the Phe_tRNA-synt_N family which is described as Aminoacyl tRNA synthetase class II, N-terminal domain (PF02912)
Residues 108 to 313 (E-value = 4.7e-131) place HD1484 in the tRNA-synt_2d family which is described as tRNA synthetases class II core domain (F) (PF01409)

PDB Hit:
pdb|1EIY|A Chain A, The Crystal Structure Of Phenylalanyl-Trna ... 281 9e-077

Gene Protein Sequence:
MQHLDKLVAQVLESINTATDVATLETLKVEFFGKKGHFTQLMQGLRDIPA
EQRPAVGQKINDAKQIAQNALNQKKEALENTELNEKLAKESIDVSLPGRK
SALGGLHPVSITIDRVVKFFSELGFTVANGPEIESDYYNFDALNIPTHHP
ARADHDTFWFDAQRLLRTQTSGVQIRTMQTTQPPIRIVAPGRVYRNDYDQ
THTPMFHQIELLYIDKKANFTELKGLIHDFLKAFFEEDLQVRFRPSFFPF
TEPSAEVDVMRQNGKWLEVLGCGMVHPNVLRNVGIDPEEYSGFAVGMGVE
RLTMLRYNVTDLRAFFENDLRFLKQFR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACATTTAGACAAATTAGTCGCGCAAGTGCTTGAGTCAATCAATAC
TGCGACTGATGTAGCCACCTTAGAAACATTAAAAGTAGAGTTTTTTGGTA
AAAAAGGCCACTTTACTCAATTAATGCAAGGCTTACGTGATATACCTGCT
GAACAACGCCCTGCGGTTGGTCAGAAAATTAACGATGCTAAACAAATTGC
ACAAAATGCCTTAAATCAGAAAAAAGAAGCTTTAGAAAATACTGAATTAA
ATGAAAAATTAGCAAAGGAAAGTATTGATGTTTCATTACCAGGCCGTAAA
AGCGCATTAGGTGGTTTACATCCAGTATCTATCACGATTGACCGCGTGGT
TAAATTCTTTTCAGAATTAGGCTTTACGGTTGCTAATGGTCCTGAAATTG
AAAGTGATTATTACAATTTTGATGCATTAAATATCCCTACTCATCACCCC
GCTAGAGCTGATCACGATACTTTTTGGTTTGATGCACAGCGTTTACTCCG
TACACAAACCTCAGGCGTACAAATTCGTACAATGCAAACAACACAGCCAC
CTATCCGCATAGTTGCACCGGGCCGTGTATATCGTAATGATTACGATCAA
ACACATACGCCTATGTTCCACCAAATTGAGTTATTATATATTGATAAAAA
AGCTAATTTTACTGAATTAAAAGGCTTAATTCACGATTTCTTAAAAGCTT
TTTTTGAAGAAGATTTACAAGTGCGTTTTCGTCCATCTTTTTTTCCGTTT
ACGGAACCCTCTGCAGAAGTTGATGTTATGCGCCAAAATGGTAAATGGTT
GGAAGTATTAGGTTGTGGAATGGTTCACCCTAATGTCCTTCGTAACGTTG
GCATTGATCCTGAAGAATACAGTGGTTTCGCAGTAGGAATGGGCGTCGAA
CGTTTAACTATGTTGCGATACAATGTCACGGATTTACGCGCATTCTTTGA
AAATGATTTACGCTTTTTAAAGCAATTTAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy