Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1094 IGR1098 IGR1093 IGR1097 IGR1095 IGR1091 IGR1092 IGR1096 ihfA, - HD1482 HD1489 nlpC, - HD1481 HD1487 pheS, - HD1484 rnd, - HD1478 pheT, - HD1483 frxA, - HD1485 HD1479 ihfA, - HD1482 HD1489 nlpC, - HD1481 HD1487 pheS, - HD1484 rnd, - HD1478 pheT, - HD1483 frxA, - HD1485 HD1479 ihfA, - HD1482 nlpC, - HD1481 HD1487 pheS, - HD1484 rnd, - HD1478 pheT, - HD1483 HD1486 HD1486 HD1489 frxA, - HD1485 HD1479 bioD,dtbS, - HD1480 bioD,dtbS, - HD1480
* Calculated from Protein Sequence

Gene ID: HD1483

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pheT  

Definition:
phenylalanyl-tRNA synthetase beta subunit

Gene Start:
1220756

Gene Stop:
1218369

Gene Length:
2388

Molecular Weight*:
87377

pI*:
5.00

Net Charge*:
-21.39

EC:
6.1.1.20  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Fayat,G., Mayaux,J.F., Sacerdot,C., Fromant,M., Springer,M.,
Grunberg-Manago,M. and Blanquet,S.
Escherichia coli phenylalanyl-tRNA synthetase operon region.
Evidence for an attenuation mechanism. Identification of the gene
for the ribosomal protein L20
J. Mol. Biol. 171 (3), 239-261 (1983)
Medline: 84090239

Kast,P. and Hennecke,H.
Amino acid substrate specificity of Escherichia coli
phenylalanyl-tRNA synthetase altered by distinct mutations
J. Mol. Biol. 222 (1), 99-124 (1991)
Medline: 92046090

Kast,P., Wehrli,C. and Hennecke,H.
Impaired affinity for phenylalanine in Escherichia coli phenylalanyl-tRNA synthetase mutant caused by Gly-to-Asp exchange
in motif 2 of class II tRNA synthetases
FEBS Lett. 293 (1-2), 160-163 (1991)
Medline: 92070551

Kast,P., Keller,B. and Hennecke,H.
Identification of the pheS5 mutation, which causes thermosensitivity of Escherichia coli mutant NP37
J. Bacteriol. 174 (5), 1686-1689 (1992)
Medline: 92165746

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to phenylalanyl-tRNA synthetase beta subunit. Residues 1-795 are 66% similar to this enzyme from Pasteurella multocida (15602494|) and are 67% similar to this enzyme from Haemophilus influenzae (1174508|).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0072
COG name: Phenylalanyl-tRNA synthetase beta subunit
Functional Class: J
The phylogenetic pattern of COG0072 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002547 (Putative tRNA binding domain) with a combined E-value of 2.3e-13.
    IPB002547A    56-70
    IPB002547B    104-121


ProDom Summary:  Protein Domain Search
Residues 1-44 are 77% similar to a (SYNTHETASE BETA LIGASE CHAIN) protein domain (PD030551) which is seen in SYFB_PASMU.

Residues 200-299 are 73% similar to a (SYNTHETASE BETA LIGASE CHAIN) protein domain (PD400842) which is seen in SYFB_HAEIN.

Residues 303-401 are 71% similar to a (SYNTHETASE BETA CHAIN LIGASE) protein domain (PD217334) which is seen in SYFB_HAEIN.

Residues 414-684 are 62% similar to a (SYNTHETASE BETA CHAIN LIGASE) protein domain (PD003388) which is seen in SYFB_HAEIN.

Residues 124-294 are 60% similar to a (SYNTHETASE BETA CHAIN LIGASE) protein domain (PD351643) which is seen in SYFB_VIBCH.

Residues 697-794 are 68% similar to a (SYNTHETASE LIGASE CHAIN ALPHA) protein domain (PD006935) which is seen in SYFB_PASMU.

Residues 45-121 are 87% similar to a (SYNTHETASE BETA CHAIN LIGASE) protein domain (PD009777) which is seen in SYFB_HAEIN.



Paralogs:  Local Blast Search


HD1483 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 45 to 147 (E-value = 3.6e-37) place HD1483 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)
Residues 152 to 296 (E-value = 1.2e-70) place HD1483 in the B3_4 family which is described as B3/4 domain (PF03483)
Residues 404 to 472 (E-value = 2.5e-25) place HD1483 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)
Residues 701 to 794 (E-value = 2.7e-36) place HD1483 in the FDX-ACB family which is described as Ferredoxin-fold anticodon binding domain (PF03147)

PDB Hit:
pdb|1PYS|B Chain B, Phenylalanyl-Trna Synthetase From Thermus T... 367 4e-102

Gene Protein Sequence:
MKFNESWLREWVDPKVSTAQLCDQITMLGLEVDSVEPISGEFSGVVVAEV
VECTQHPDADKLRVTKVNVGAERLLSIVCGAANCRQGLKVACAIEGAILP
GNFKIKKTKLRGQLSEGMLCSFSELGIKEDQSSGIIELPADAPIGVDIRE
YLNLNDVAIEVSLTPNRADCLSIAGIAREVAVINQMEVKSPVIKPVPATL
SAPIEIDIQAPSACPHYLARIIKNVNVNATSPLWLQEKLRRCGILSIDPI
VDITNLSLLELGQPMHAFDAEKVKAPIQVRLAKDQEQLVLLDGTTAKLQT
NTLVIADQKNVLALAGIMGGEASKVNAETKDIILEAAFFAPLALTGRTRQ
YGLHTDASHRFERGVDPTLARQAMERATTLIIEICGGEVAEVCEAINTEY
LPKQPIIRLRRTKLDSVIGHYIEDRLVTDILVRLGLNVTCENDGWIATVP
SWRFDLEIEEDLIEEIARIYGYNRIPNNALLAHLTLKGSAEKVLEPNRIK
TVLVDNDYQEVVTYSFVDPKIQQLLHPQQEALILPNPISSEMSAMRVSLL
TGLLQTVLYNQNRQQNRIRIFEQGLRFIPDASAESAVRQEAVFAAVIVGE
KHIANWEGKSKAVDFFDLKGDLEQILALTANKELTFVAKQFPALHPGQSA
AIMLNEQEVGFIGTLHPSIGQKLGIKGTPIVFELLADVVSERAIPVAKEI
SKFPANNRDIAIVIDEHIPAREVLSACYHAGREQLTAVNLFDVYQGANLV
VGKKSLAISLTIQNTEKTLTEEEISAVIQLVLDELAQRFQASLRD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTTTAATGAATCTTGGTTACGTGAATGGGTTGATCCTAAGGTATC
TACAGCACAATTGTGTGATCAAATTACAATGTTAGGTTTAGAAGTTGATA
GTGTAGAACCCATTTCCGGTGAGTTTAGCGGTGTGGTAGTGGCTGAAGTT
GTTGAGTGTACACAACATCCAGACGCAGATAAATTACGTGTAACAAAAGT
CAATGTCGGTGCAGAGCGTTTATTAAGTATTGTTTGTGGCGCGGCTAACT
GTCGTCAAGGGTTAAAAGTTGCTTGTGCTATAGAAGGTGCTATTTTACCG
GGTAATTTTAAAATTAAAAAAACCAAACTGCGTGGTCAGTTATCAGAAGG
AATGTTATGTTCATTTTCAGAATTAGGCATTAAAGAGGATCAGAGTAGCG
GTATCATTGAATTACCTGCTGATGCACCTATCGGTGTTGATATTCGTGAG
TATTTAAATTTAAATGATGTAGCAATTGAGGTTAGTTTAACACCCAATCG
AGCGGACTGTTTAAGTATTGCCGGTATTGCACGTGAAGTGGCGGTGATTA
ATCAAATGGAAGTTAAATCACCGGTTATCAAACCGGTTCCTGCTACACTA
TCTGCGCCAATTGAAATTGATATACAAGCACCATCTGCTTGCCCTCATTA
TTTAGCACGAATTATTAAGAATGTTAATGTAAACGCAACGTCACCATTAT
GGTTACAAGAAAAATTACGTCGTTGTGGTATTCTCTCCATTGATCCAATT
GTCGATATTACAAATTTAAGTTTACTTGAATTAGGCCAGCCAATGCATGC
TTTTGATGCCGAGAAGGTAAAGGCCCCTATTCAAGTCCGCCTAGCAAAAG
ATCAAGAGCAGTTAGTTTTATTAGATGGTACCACGGCGAAGTTACAAACG
AATACATTAGTCATTGCTGATCAAAAAAATGTCCTTGCACTTGCTGGGAT
TATGGGCGGAGAAGCAAGCAAAGTAAATGCTGAAACAAAAGATATCATTT
TAGAAGCGGCATTTTTTGCACCATTAGCGCTCACCGGCCGTACACGTCAA
TATGGCTTACATACAGACGCCTCGCATCGTTTTGAACGTGGTGTAGACCC
AACGCTTGCTCGTCAAGCAATGGAGCGCGCAACTACATTGATCATAGAGA
TTTGTGGCGGTGAAGTCGCTGAAGTATGTGAAGCGATAAATACTGAATAT
TTACCAAAACAGCCGATCATTCGCTTACGTCGTACCAAATTAGATTCAGT
GATAGGCCATTATATTGAAGATAGGCTAGTGACGGATATTTTAGTTCGCT
TAGGGCTAAATGTGACATGCGAAAATGATGGCTGGATAGCCACTGTACCT
AGTTGGCGTTTCGATCTTGAAATTGAAGAAGATCTAATTGAAGAAATTGC
GCGCATTTATGGGTATAATCGCATTCCAAATAATGCATTATTAGCGCATT
TAACGCTTAAAGGAAGCGCTGAGAAAGTATTAGAACCTAACCGGATTAAA
ACGGTTTTAGTTGATAATGACTATCAAGAAGTCGTGACTTATAGTTTTGT
TGATCCTAAAATTCAACAATTGCTACATCCACAACAAGAAGCCTTAATTT
TACCTAATCCAATTTCAAGCGAAATGTCCGCTATGCGCGTATCGCTATTA
ACGGGTTTGTTACAAACTGTGCTATATAACCAAAATCGCCAACAAAACCG
TATTCGCATTTTCGAACAAGGGCTGCGTTTTATTCCTGATGCAAGCGCAG
AATCAGCCGTTCGCCAAGAAGCTGTTTTTGCAGCTGTGATTGTCGGCGAA
AAACATATTGCGAATTGGGAAGGTAAATCAAAAGCGGTTGATTTCTTTGA
TTTAAAAGGCGATTTAGAACAAATATTAGCATTAACGGCAAATAAAGAAT
TAACATTTGTCGCAAAACAATTTCCGGCATTACATCCCGGTCAATCAGCT
GCTATTATGCTAAATGAACAAGAAGTTGGTTTTATCGGCACGCTTCACCC
AAGTATTGGCCAAAAATTAGGTATTAAAGGCACTCCAATTGTATTTGAGT
TATTAGCTGATGTTGTTTCAGAACGCGCTATTCCTGTTGCCAAAGAGATT
TCTAAATTTCCAGCTAATAATCGTGATATAGCGATTGTTATTGATGAACA
TATTCCTGCACGTGAAGTTCTTTCTGCTTGTTATCATGCGGGTCGTGAAC
AACTCACAGCGGTTAATTTGTTTGATGTTTACCAAGGCGCAAATTTAGTA
GTTGGTAAGAAAAGTTTAGCAATTAGTTTAACCATTCAAAATACAGAAAA
AACGCTTACTGAAGAAGAAATTTCAGCTGTTATACAACTAGTCTTAGACG
AATTAGCACAGCGTTTTCAGGCTTCTTTGAGAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy