Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1089 IGR1094 IGR1093 IGR1095 IGR1090 IGR1091 IGR1092 IGR1096 ihfA, - HD1482 lrp, - HD1477 nlpC, - HD1481 pheS, - HD1484 rnd, - HD1478 pheT, - HD1483 ftsK, - HD1476 HD1479 ihfA, - HD1482 lrp, - HD1477 nlpC, - HD1481 pheS, - HD1484 rnd, - HD1478 pheT, - HD1483 ftsK, - HD1476 HD1479 ihfA, - HD1482 lrp, - HD1477 nlpC, - HD1481 pheS, - HD1484 rnd, - HD1478 pheT, - HD1483 ftsK, - HD1476 HD1479 bioD,dtbS, - HD1480 bioD,dtbS, - HD1480
* Calculated from Protein Sequence

Gene ID: HD1480

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
bioD  dtbS  

Definition:
dethiobiotin synthetase homolog

Gene Start:
1216450

Gene Stop:
1217286

Gene Length:
837

Molecular Weight*:
31411

pI*:
7.30

Net Charge*:
1.17

EC:
6.3.3.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Primary Evidence:
NULL

Secondary Evidence:
Sakurai N, Akatsuka H, Kawai E, Imai Y, Komatsubara S.
Complete sequence and organization of the Serratia marcescens biotin operon.
Microbiology. 1996 Nov;142 ( Pt 11):3295-303.
PMID: 8969526

Bower S, Perkins JB, Yocum RR, Howitt CL, Rahaim P, Pero J.
Cloning, sequencing, and characterization of the Bacillus subtilis biotin biosynthetic operon.
J Bacteriol. 1996 Jul;178(14):4122-30.
PMID: 8763940

Comment:
For other biotin-related genes, see HD0634, HD0635, HD1007, HD1394, HD0082, HD1680, HD1681.

Blast Summary:  PSI-Blast Search
Residues 42-272 are 55% similar to residues 3-235 of 15602506 BioD1 [Pasteurella multocida]. Residues 42-273 are 49% similar to residues 3-234 of 16273352 dethiobiotin synthase (bioD-1) [Haemophilus influenzae Rd].

COGS Summary:  COGS Search
BeTs to 9 clades of COG0132
COG name: Dethiobiotin synthetase
Functional Class: H
The phylogenetic pattern of COG0132 is -m--yq-cEbrHuj-----n-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 224-272 are 67% similar to a (DETHIOBIOTIN SYNTHETASE BIOSYNTHESIS) protein domain (PD036311) which is seen in Q9CN08_PASMU.

Residues 44-223 are 52% similar to a (DETHIOBIOTIN SYNTHETASE DTBS SYNTHASE) protein domain (PD003986) which is seen in Q9CN08_PASMU.



Paralogs:  Local Blast Search

HD1480 is paralogously related to HD1680 (7e-14).


Pfam Summary:  Pfam Search
Residues 42 to 259 (E-value = 2.6e-19) place HD1480 in the CbiA family which is described as Cobyrinic acid a,c-diamide synthase (PF01656)

PDB Hit:
pdb|1BYI| Structure Of Apo-Dethiobiotin Synthase At 0.97 Ang... 164 1e-041
pdb|1DTS| Dethiobiotin Synthase (E.C.6.3.3.3) 164 1e-041

Gene Protein Sequence:
LFSDKTRNLSRKFDQEHHYTLKKVLKYKQFCNYFVKRKKIPSLFITGTDT
NVGKTIVTRAILQVLAQHNFSVVGYKPIACGGDDDLPTEPNQTDYTSEDN
SDVLIILDSCPQPVAYRDINSYTFTHSSTPIFAALDAVHHIQEEKLDTDL
SNLQQNYPNVVVEGTYGWLTPINKDLSFAEWVHKNNMPAVLVVGIKEGCV
NHALLTAQAIQQQGVNLIGWVANRINPCLRHYAELIELLSKKISAPLLGQ
IPYIAQPHKKDLTSYIENPDPLLAYFQK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTCAGCGATAAAACAAGGAATTTATCAAGGAAATTTGATCAAGAACA
TCATTACACCTTAAAAAAAGTATTAAAATATAAACAATTTTGTAATTATT
TTGTTAAGAGGAAAAAGATACCTTCGTTATTCATTACTGGTACAGATACT
AATGTTGGAAAAACCATTGTTACCCGAGCGATTCTTCAAGTTTTAGCACA
GCATAATTTTTCCGTTGTTGGTTATAAGCCGATTGCGTGTGGTGGCGATG
ATGATCTGCCAACTGAACCCAATCAAACAGACTATACTAGTGAAGATAAC
TCAGATGTGCTCATCATATTAGACAGCTGTCCTCAACCTGTCGCATATCG
TGATATCAATAGTTATACATTTACACACTCAAGCACGCCAATTTTTGCTG
CGCTTGATGCGGTACATCATATTCAAGAGGAAAAGTTAGATACAGATCTT
AGCAATTTACAACAAAATTACCCTAATGTAGTGGTAGAAGGCACTTATGG
TTGGCTAACGCCGATTAATAAAGATCTCAGCTTTGCTGAATGGGTACACA
AAAATAATATGCCTGCGGTGTTAGTTGTAGGTATTAAAGAAGGCTGTGTT
AACCACGCATTATTAACGGCTCAAGCTATTCAGCAACAAGGTGTTAATCT
AATAGGTTGGGTAGCAAATAGAATTAATCCGTGCTTGCGCCATTATGCTG
AACTGATTGAATTATTAAGTAAAAAAATTAGCGCTCCATTGCTAGGACAA
ATTCCTTATATTGCCCAACCTCACAAAAAAGACTTAACCTCCTATATTGA
AAATCCCGATCCTTTATTAGCATATTTCCAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy