Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1089 IGR1094 IGR1093 IGR1090 IGR1091 IGR1092 IGR1088 ihfA, - HD1482 lrp, - HD1477 nlpC, - HD1481 aroG,kdo, - HD1475 rnd, - HD1478 pheT, - HD1483 ftsK, - HD1476 HD1479 ihfA, - HD1482 lrp, - HD1477 nlpC, - HD1481 aroG,kdo, - HD1475 rnd, - HD1478 pheT, - HD1483 ftsK, - HD1476 HD1479 ihfA, - HD1482 lrp, - HD1477 nlpC, - HD1481 aroG,kdo, - HD1475 rnd, - HD1478 pheT, - HD1483 ftsK, - HD1476 HD1479 bioD,dtbS, - HD1480 bioD,dtbS, - HD1480
* Calculated from Protein Sequence

Gene ID: HD1478

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rnd  

Definition:
ribonuclease D (rnd)

Gene Start:
1215133

Gene Stop:
1214012

Gene Length:
1122

Molecular Weight*:
43245

pI*:
8.70

Net Charge*:
4.56

EC:
3.1.26.3  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Fulda,M., Heinz,E. and Wolter,F.P.
The fadD gene of Escherichia coli K12 is located close to rnd at
39.6 min of the chromosomal map and is a new member of the
AMP-binding protein family
Mol. Gen. Genet. 242 (3), 241-249 (1994)
Medline: 94150456


Comment:


Blast Summary:  PSI-Blast Search
Strong hits to RND_HAEIN (1e-102) and RND_ECOLI (7e-93) only. The N-terminus is similar to human autoantigens PM-SCL (ref|NP_002676.1) and to hypothetical proteins

COGS Summary:  COGS Search
BeTs to 5 clades of COG0349
COG name: Ribonuclease D
Functional Class: J
The phylogenetic pattern of COG0349 is ----y--ce-rh--------X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-121 are 60% similar to a (RIBONUCLEASE PROTEOME COMPLETE TRNA) protein domain (PD112641) which is seen in Q9CMV0_PASMU.

Residues 278-371 are 48% similar to a (RIBONUCLEASE EXONUCLEASE COMPLETE TRNA) protein domain (PD037601) which is seen in Q9CMV0_PASMU.

Residues 125-277 are 60% similar to a (PROTEOME COMPLETE RIBONUCLEASE) protein domain (PD002549) which is seen in Q9CMV0_PASMU.

Residues 123-170 are 68% similar to a (HELICASE ATP-BINDING SYNDROME ERNER) protein domain (PD254697) which is seen in Q9KQL4_VIBCH.



Paralogs:  Local Blast Search

HD1478 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 175 (E-value = 1.3e-55) place HD1478 in the 3_5_exonuc family which is described as 3'-5' exonuclease (PF01612)
Residues 214 to 292 (E-value = 7.1e-11) place HD1478 in the HRDC family which is described as HRDC domain (PF00570)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNSRIDYKWIDTNEKLATVCQQASDKTAIALDTEFIRTRSYYPKFGLIQL
FDGEQTSLIDPTTISDFLPFIDLLANPNIVKVLHACSEDLEIFQHQFNQA
LTPLIDTQIMAAFSGLGLSIGFAKLVNHYLNIELDKGASRTDWLARPLTE
TQLQYAAADVYYLLPIYQKLQAELAQTNWQEAVNQECQLLVNKRNKTLEL
NDAYKEISYAWTLTRQQLAILKLLAKWRIEEARKRDLALNFVIKEQSLIE
IAKSQPKHTSQLLTFMHPNEVRIHGKKILWLVEQAKIISEQDYPLLITRL
VDQPHYKYNLKIMQKKISEIRPPDLPQELLASKRQLNQLLKWYQKGQSQQ
YLPELLSGWRAEFGKQILSALIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACTCAAGGATTGATTATAAATGGATAGATACTAATGAGAAATTAGC
CACGGTTTGTCAGCAAGCAAGTGATAAAACGGCTATAGCATTAGATACAG
AATTTATTCGTACTCGATCTTATTATCCTAAATTCGGTTTAATTCAATTG
TTTGATGGTGAACAAACCAGTTTGATTGATCCTACAACAATTAGTGATTT
TTTGCCTTTTATTGATTTATTAGCAAACCCTAATATTGTAAAAGTATTAC
ACGCGTGCAGTGAGGATCTGGAAATATTTCAACATCAGTTTAATCAAGCG
CTTACTCCATTAATAGACACGCAAATTATGGCGGCTTTTAGTGGTCTTGG
TCTATCGATCGGGTTTGCAAAGCTAGTGAATCATTATTTAAACATCGAAT
TAGATAAAGGCGCATCTCGCACTGACTGGCTGGCTCGTCCGTTAACTGAA
ACACAGTTACAGTATGCAGCCGCAGATGTATATTATTTATTACCTATTTA
TCAAAAATTGCAAGCAGAGCTTGCTCAAACTAACTGGCAAGAGGCGGTAA
ATCAAGAATGCCAACTTTTAGTGAATAAGCGTAATAAAACATTAGAATTG
AATGATGCTTATAAAGAGATAAGCTATGCTTGGACTTTAACTAGACAGCA
ATTAGCTATTTTGAAATTACTAGCAAAATGGAGAATAGAAGAAGCCAGAA
AACGCGATCTAGCCTTGAATTTTGTCATAAAAGAACAAAGTTTAATTGAA
ATCGCCAAATCACAACCTAAACATACATCACAATTATTAACTTTTATGCA
TCCAAATGAAGTACGTATTCATGGCAAAAAAATATTATGGCTAGTTGAAC
AAGCTAAAATAATCTCAGAGCAAGATTATCCACTCTTAATTACACGTTTA
GTTGATCAACCACATTATAAATATAATTTAAAAATAATGCAGAAAAAGAT
CTCTGAAATTAGACCGCCTGATTTACCACAAGAATTACTAGCAAGTAAAC
GGCAGTTAAATCAACTGTTGAAATGGTATCAGAAAGGGCAGAGCCAACAA
TACTTACCTGAATTATTAAGCGGTTGGCGGGCTGAATTCGGCAAACAGAT
ATTAAGCGCACTCATAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy