Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1089 IGR1087 IGR1086 IGR1085 IGR1082 IGR1090 IGR1083 IGR1084 IGR1088 lrp, - HD1477 HD1474 aroG,kdo, - HD1475 rnd, - HD1478 ftsK, - HD1476 HD1472 tdk, - HD1473 cpxR,basR, - HD1469 HD1471 cpxA,basS, - HD1470 lrp, - HD1477 HD1474 aroG,kdo, - HD1475 rnd, - HD1478 ftsK, - HD1476 HD1472 tdk, - HD1473 cpxR,basR, - HD1469 HD1471 cpxA,basS, - HD1470 lrp, - HD1477 HD1474 aroG,kdo, - HD1475 rnd, - HD1478 ftsK, - HD1476 HD1472 tdk, - HD1473 cpxR,basR, - HD1469 HD1471 cpxA,basS, - HD1470
* Calculated from Protein Sequence

Gene ID: HD1475

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroG  kdo  

Definition:
phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase)

Gene Start:
1210326

Gene Stop:
1209214

Gene Length:
1113

Molecular Weight*:
40723

pI*:
6.40

Net Charge*:
-4.18

EC:
4.1.2.15  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Parish T, Stoker NG.
The common aromatic amino acid biosynthesis pathway is essential in Mycobacterium tuberculosis.
Microbiology. 2002 Oct;148(Pt 10):3069-77.
PMID: 12368440

Jiang PH, Liu AM, Ge HP, Zhang YY, Fan CS, Huang WD.
Cloning and Expression of aroG Gene of E. coli and Its Co-expression with pheA and tyrB Genes.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai).
1998;30(6):593-596.
PMID: 12167994

Jiang PH, Shi M, Qian ZK, Li NJ, Huang WD.
Effect of F209S Mutation of Escherichia coli AroG on Resistance to Phenylalanine Feedback Inhibition.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai). 2000;32(5):441-444.
PMID: 12058188

Kikuchi Y, Tsujimoto K, Kurahashi O.
Mutational analysis of the feedback sites of phenylalanine-sensitive 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase of
Escherichia coli.
Appl Environ Microbiol. 1997 Feb;63(2):761-2.
PMID: 9023954

Comment:
For other "aro" genes, see HD1274 (aroC), HD1383 (aroA), HD0415 (aroE), HD0422 (aroB), HD0423 (aroK), HD0444 (aroF), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Many strong hits to phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase), e.g. residues 5-359 are 72% similar to 16273447 phospho-2-dehydro-3-deoxyheptonate aldolase
(phenylalanine repressible) (aroG) from Haemophilus influenzae Rd.
Residues 4-354 are 73% similar to 15602428 AroG [Pasteurella
multocida].

COGS Summary:  COGS Search
BeTs to 3 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001785 (DAHP synthetase class I) with a combined E-value of 1.9e-177.
    IPB001785A    6-29
    IPB001785B    40-73
    IPB001785C    91-131
    IPB001785D    139-190
    IPB001785E    209-237
    IPB001785F    265-308
    IPB001785G    325-346
    IPB001785B    43-76


ProDom Summary:  Protein Domain Search
Residues 4-350 are 73% similar to a (ALDOLASE PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE DAHP) protein domain (PD005060) which is seen in Q9CN76_PASMU.



Paralogs:  Local Blast Search
HD1475 is paralogously related to HD0444 (1e-83).


Pfam Summary:  Pfam Search
Residues 25 to 344 (E-value = 5.3e-153) place HD1475 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

PDB Hit:
pdb|1GG1|A Chain A, Crystal Structure Analysis Of Dahp Synthase... 472 4e-134

Gene Protein Sequence:
MPYKNDDLRITKIEQLLPPIALLERFPASDVAEHTVARAREAIHKIIHGE
DDRLLVVIGPCSIHDPESALDYAKRIKALRDNPQINQNLELVMRVYFEKP
RTTVGWKGLINDPYLNETYALNDGLRIARKVLSDINDLTVPAAGEFLDMI
IPQYVADFMSWGAIGARTAESQVHRELASGLSCAVGFKNATNGSVKTALD
AIKSAEVSHHFLSVTKFAHSAVISTAGNEDCHIILRGGDNGTNYDIASVK
KVCADIEKAGRRPHVMIDFSHANSQKQFKRQMEVCTNVCQQIANGSSLIS
GVMIESHLVEGRQDLVEGGLDKLVYGQSVTDACIGWEDSETALFALAEAV
ALRRQRTNNNANDLVNHIVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTATAAAAATGATGATCTTCGTATCACTAAAATTGAACAGCTATT
ACCCCCGATCGCTTTATTAGAGCGTTTTCCAGCCAGTGATGTTGCTGAGC
ATACTGTTGCTAGAGCAAGAGAAGCTATTCATAAAATTATTCACGGTGAA
GACGATCGTTTATTAGTTGTTATTGGGCCTTGCTCAATTCATGATCCAGA
ATCTGCTCTAGATTATGCTAAACGAATTAAAGCATTACGTGATAATCCAC
AGATTAATCAAAACTTAGAGTTAGTAATGCGCGTTTATTTTGAAAAACCA
CGAACAACCGTTGGTTGGAAAGGGTTAATTAATGACCCCTATCTGAATGA
AACTTATGCATTAAACGATGGTTTACGAATTGCACGAAAAGTACTGTCCG
ATATTAATGATTTAACCGTGCCTGCCGCGGGTGAGTTTTTAGATATGATC
ATTCCACAATATGTAGCCGATTTTATGAGTTGGGGAGCCATTGGAGCACG
GACCGCTGAATCACAAGTTCATCGTGAGTTAGCCTCAGGTTTATCTTGTG
CGGTAGGTTTCAAAAATGCCACTAATGGCAGTGTTAAAACCGCTTTAGAT
GCAATAAAATCTGCTGAAGTTTCACATCACTTCTTATCCGTGACCAAATT
TGCTCATTCAGCTGTTATTTCTACCGCAGGTAATGAGGATTGCCACATTA
TTTTGCGTGGTGGCGATAATGGCACAAATTATGATATTGCGTCTGTAAAA
AAAGTGTGTGCAGATATTGAGAAAGCAGGGCGGCGTCCTCACGTAATGAT
TGACTTTAGTCATGCTAATAGCCAAAAACAATTTAAACGACAAATGGAAG
TTTGTACTAATGTATGCCAACAGATTGCAAATGGTTCATCATTAATTTCT
GGTGTGATGATAGAAAGCCATTTAGTCGAAGGTCGGCAAGATCTTGTCGA
AGGTGGTTTAGATAAATTAGTATATGGTCAAAGTGTTACAGATGCTTGTA
TTGGTTGGGAAGACAGCGAAACAGCACTGTTTGCCTTAGCTGAAGCGGTC
GCATTACGCCGACAACGGACCAACAATAATGCTAATGATTTGGTTAATCA
TATAGTAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy