Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1087 IGR1086 IGR1085 IGR1081 IGR1082 IGR1083 IGR1084 IGR1088 IGR1080 HD1474 accD, - HD1466 aroG,kdo, - HD1475 ftsK, - HD1476 HD1472 tdk, - HD1473 cpxR,basR, - HD1469 HD1471 mazG, - HD1468 cpxA,basS, - HD1470 HD1474 accD, - HD1466 aroG,kdo, - HD1475 ftsK, - HD1476 HD1472 tdk, - HD1473 cpxR,basR, - HD1469 HD1471 mazG, - HD1468 cpxA,basS, - HD1470 HD1474 accD, - HD1466 aroG,kdo, - HD1475 ftsK, - HD1476 HD1472 tdk, - HD1473 cpxR,basR, - HD1469 HD1471 mazG, - HD1468 cpxA,basS, - HD1470
* Calculated from Protein Sequence

Gene ID: HD1473

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tdk  

Definition:
thymidine kinase

Gene Start:
1207851

Gene Stop:
1208447

Gene Length:
597

Molecular Weight*:
22840

pI*:
8.20

Net Charge*:
3.68

EC:
2.7.1.21  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Franke CA, Bolman TM, Ottum SA, Jones KF, Hruby DE.
Streptococcus gordonii strains resistant to fluorodeoxyuridine contain mutations in the thymidine kinase gene and are deficient in thymidine kinase activity.
Antimicrob Agents Chemother. 2000 Mar;44(3):787-9.
PMID: 10681361

McNab R.
Cloning and sequence analysis of thymidine kinase from the oral bacterium Streptococcus gordonii.
FEMS Microbiol Lett. 1996 Jan 1;135(1):103-10.
PMID: 8598265





Comment:
From Genbank:[gi:20138784]
This enzyme phosphorylates both thymidine and deoxyuridine.

Blast Summary:  PSI-Blast Search
Many significant hits in gapped BLAST to thymidine kinases.
Residues 1-193 are 73% similar to this enzyme from Haemophilus influenzae (1170667|) and residues 1-189 are 75% similar to this enzyme from Pasteurella multocida (15603101|).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1435
COG name: Thymidine kinase
Functional Class: F
The phylogenetic pattern of COG1435 is ------v-eb-h--gpo----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001267 (Thymidine kinase cellular-type) with a combined E-value of 1.5e-44.
    IPB001267A    9-21
    IPB001267B    80-94
    IPB001267C    104-148
    IPB001267D    172-186


ProDom Summary:  Protein Domain Search
Residues 1-188 are 67% similar to a (KINASE DNA ATP-BINDING SYNTHESIS) protein domain (PD100754) which is seen in Q9KST9_VIBCH.

Residues 4-186 are 73% similar to a (KINASE THYMIDINE TRANSFERASE ATP-BINDING) protein domain (PD002207) which is seen in KITH_HAEIN.



Paralogs:  Local Blast Search
HD1473 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 186 (E-value = 3.9e-95) place HD1473 in the TK family which is described as Thymidine kinase (PF00265)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAKLYFYYSAMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGIGKVC
SRIGISQEAKLFYTDTNFLEQVEQVLKAKKLHCIMIDEAQFLTKKQVHQL
TDVVDELKIPVLCYGLRTDFQKELFEGSQYLLAWADELQELKTICECGKK
AHFVIRLNENGETVTTGEQIQIGGNDKYISVCRYHYKKKRGELRQITK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAACTTTATTTTTATTATTCTGCAATGAATGCAGGTAAATCGAC
TACTCTGCTTCAGTCTTCTTATAATTATCAAGAACGCGGTATGAATACGT
TAGTTTATACTGCGGCAATTGATGATCGTTATGGGATAGGCAAAGTCTGT
TCACGTATTGGTATTTCGCAAGAAGCAAAACTATTTTATACAGATACAAA
CTTTCTAGAGCAAGTTGAGCAAGTCCTTAAGGCTAAAAAATTACACTGTA
TTATGATTGATGAAGCGCAATTTCTAACTAAAAAGCAAGTTCATCAATTG
ACGGATGTGGTTGATGAATTAAAGATTCCTGTGCTTTGTTATGGGCTACG
AACTGATTTTCAAAAAGAGTTATTTGAGGGGAGCCAGTATTTATTAGCTT
GGGCGGATGAATTGCAAGAGTTAAAAACAATTTGTGAATGTGGAAAAAAA
GCGCATTTTGTCATTCGTTTAAACGAGAATGGTGAAACGGTTACAACAGG
TGAGCAAATTCAGATTGGCGGGAATGATAAGTATATTTCAGTTTGTCGTT
ATCACTATAAAAAAAAACGAGGTGAATTAAGGCAAATTACTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy