Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR1078 IGR1081 IGR1082 IGR1083 IGR1084 IGR1080 IGR1079 accD, - HD1466 folC,accD, - HD1465 nusA, - HD1462 infB,IF2, - HD1461 HD1472 cpxR,basR, - HD1469 HD1471 mazG, - HD1468 cpxA,basS, - HD1470 accD, - HD1466 folC,accD, - HD1465 nusA, - HD1462 infB,IF2, - HD1461 HD1472 cpxR,basR, - HD1469 HD1471 mazG, - HD1468 cpxA,basS, - HD1470 accD, - HD1466 folC,accD, - HD1465 nusA, - HD1462 infB,IF2, - HD1461 HD1463 HD1463 cpxR,basR, - HD1469 HD1471 mazG, - HD1468 cpxA,basS, - HD1470 HD1472
* Calculated from Protein Sequence

Gene ID: HD1466

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
accD  

Definition:
acetyl-CoA carboxylase carboxyltransferase, beta

Gene Start:
1203152

Gene Stop:
1202262

Gene Length:
891

Molecular Weight*:
32690

pI*:
8.00

Net Charge*:
2.46

EC:
6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism

Secondary Evidence:
Li,S.J. and Cronan,J.E. Jr.
Growth rate regulation of Escherichia coli acetyl coenzyme A
carboxylase, which catalyzes the first committed step of lipid
biosynthesis
J. Bacteriol. 175 (2), 332-340 (1993)
Medline: 93123150


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to acetyl-CoA carboxylase carboxyl transferase subunit beta. Residues 1-296 are 75% simialr to this enzyme from Pasteurella multocida (15602501|) and are 77% simialr to this enzyme from Haemophilus influenzae (1168280|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0777
COG name: Acetyl-CoA carboxylase beta subunit
Functional Class: I
The phylogenetic pattern of COG0777 is a--k-qvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01070 (Acetyl-CoA carboxylase carboxyl transferase beta subunit signature) with a combined E-value of 2.2e-53.
    PR01070A    130-144
    PR01070B    164-182
    PR01070C    201-218
    PR01070D    230-241
    PR01070E    252-261


ProDom Summary:  Protein Domain Search
Residues 130-200 are 78% similar to a (BETA CARBOXYLASE SUBUNIT TRANSFERASE) protein domain (PD001571) which is seen in ACCD_ECOLI.

Residues 28-126 are 80% similar to a (BETA TRANSFERASE CARBOXYLASE SUBUNIT) protein domain (PD003279) which is seen in ACCD_HAEIN.

Residues 1-128 are 47% similar to a (A PROTEOME BETA SUBUNIT) protein domain (PD295629) which is seen in Q9PDB2_XYLFA.

Residues 201-274 are 90% similar to a (BETA TRANSFERASE CARBOXYLASE SUBUNIT) protein domain (PD003130) which is seen in Q9CN12_PASMU.

Residues 26-125 are 29% similar to a (BETA SUBUNIT CHLOROPLAST CHAIN) protein domain (PD030260) which is seen in ACCD_PICAB.



Paralogs:  Local Blast Search
HD1466 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSWIERILGRTASSSSSSKSKVPEGVWTKCTNCEQVLYSEELKRNMQVCP
KCDHHMRFDARTRLLSLLDQGSAEEIAANLEPQDILKFKDLKKYKDRLTA
AQKQTGEKDAFITMFGTLYEMPIVVASFNFEFMGGSMGAVVGAKFVRAAE
KALAENIPFICFSASGGARMQEALFSLMQMAKTSAILAKMREKGGPFISV
LTDPTLGGVSASLAMLGDINIAEPKSLIGFAGPRVIEQTVREKLPEGFQR
AEFLLEHGAIDMIVQRKDMRDTLARLCAKMTNQPSPFKVGELIIEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTGGATTGAAAGAATTTTAGGTAGAACCGCTTCATCATCAAGCAG
TAGCAAATCTAAAGTGCCAGAAGGTGTTTGGACAAAATGTACAAACTGCG
AACAAGTTCTCTACAGTGAAGAATTAAAACGCAATATGCAAGTGTGTCCG
AAATGTGACCATCATATGCGTTTTGATGCCCGTACACGTTTATTATCTTT
ATTAGATCAAGGGAGTGCAGAAGAAATTGCTGCTAATTTAGAACCTCAAG
ATATTTTGAAATTCAAAGATCTTAAAAAATATAAAGACCGTTTAACCGCT
GCACAAAAACAAACCGGCGAGAAAGACGCTTTTATCACAATGTTTGGCAC
TTTGTATGAAATGCCGATTGTAGTAGCTTCATTTAATTTTGAGTTTATGG
GCGGATCAATGGGGGCCGTTGTGGGGGCTAAATTTGTACGTGCTGCAGAA
AAAGCATTAGCGGAGAATATCCCGTTCATCTGTTTTTCTGCTTCAGGTGG
TGCGCGTATGCAAGAAGCGTTATTCTCATTAATGCAAATGGCAAAAACAA
GTGCGATTTTAGCTAAAATGCGCGAAAAAGGGGGGCCATTTATTTCAGTA
TTAACCGATCCAACGCTAGGCGGTGTTTCAGCTAGTTTAGCTATGTTAGG
GGATATTAATATTGCTGAACCAAAATCACTAATTGGCTTTGCCGGCCCAC
GAGTCATCGAGCAAACCGTACGTGAGAAGTTACCAGAAGGCTTCCAGCGC
GCTGAATTTTTATTAGAGCATGGTGCAATTGATATGATTGTGCAACGTAA
AGATATGCGTGATACTTTAGCTCGCTTGTGTGCCAAAATGACTAATCAAC
CTTCACCATTTAAAGTTGGTGAATTAATTATTGAAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy