Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR1078 IGR1081 IGR1082 IGR1083 IGR1080 IGR1079 accD, - HD1466 folC,accD, - HD1465 nusA, - HD1462 infB,IF2, - HD1461 cpxR,basR, - HD1469 mazG, - HD1468 cpxA,basS, - HD1470 accD, - HD1466 folC,accD, - HD1465 nusA, - HD1462 infB,IF2, - HD1461 cpxR,basR, - HD1469 mazG, - HD1468 cpxA,basS, - HD1470 accD, - HD1466 folC,accD, - HD1465 nusA, - HD1462 infB,IF2, - HD1461 HD1463 HD1463 cpxR,basR, - HD1469 mazG, - HD1468 cpxA,basS, - HD1470
* Calculated from Protein Sequence

Gene ID: HD1465

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folC  accD  

Definition:
folylpolyglutamate synthase/dihydrofolate synthase

Gene Start:
1202262

Gene Stop:
1200961

Gene Length:
1302

Molecular Weight*:
48495

pI*:
6.60

Net Charge*:
-3.09

EC:
6.3.2.12  6.3.2.17  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  
Regulatory functions  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Sheng Y, Cross JA, Shen Y, Smith CA, Bognar AL.
Mutation of an essential glutamate residue in folylpolyglutamate synthetase and activation of the enzyme by pteroate binding.
Arch Biochem Biophys. 2002 Jun 1;402(1):94-103.
PMID: 12051687

Murata T, Bognar AL, Hayashi T, Ohnishi M, Nakayama K, Terawaki Y.
Molecular analysis of the folC gene of Pseudomonas aeruginosa.
Microbiol Immunol. 2000;44(11):879-86.
PMID: 11145267

Bogner,A.L., Osborne,C. and Shane,B.
Primary structure of the Escherichia coli folC gene and its
folylpolyglutamate synthetase-dihydrofolate synthetase product and
regulation of expression by an upstream gene
J. Biol. Chem. 262, 12334-12343 (1987)

Comment:
For other "fol" genes, see HD1108 (folD), HD1118 (folA), HD0978 (folB), HD0644 (folP).

Should not be confused with accD that signifies acetyl-CoA carboxylase.

Blast Summary:  PSI-Blast Search
Many strong hits to folC proteins, e.g. residues 8-427 are 59% similar to 16273179 folylpolyglutamate synthase/dihydrofolate synthase (folC) from Haemophilus influenzae Rd. Residues 9-428 are 58% similar to 15602500 FolC from Pasteurella multocida.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0285
COG name: Folylpolyglutamate synthase
Functional Class:  H
The phylogenetic pattern of COG0285 is ----Yqvcebrhuj---l--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001645 (Folylpolyglutamate synthetase) with a combined E-value of 8.9e-74.
    IPB001645A    51-75
    IPB001645B    78-98
    IPB001645C    123-158
    IPB001645D    163-196
    IPB001645E    415-428


ProDom Summary:  Protein Domain Search
Residues 130-196 are 80% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS ENZYME) protein domain (PD212530) which is seen in Q9CN13_PASMU.

Residues 198-427 are 44% similar to a (SYNTHASE FOLYLPOLYGLUTAMATE PROTEOME) protein domain (PD122334) which is seen in FOLC_HAEIN.

Residues 130-194 are 84% similar to a (SYNTHASE FOLYLPOLYGLUTAMATE SYNTHETASE) protein domain (PD003937) which is seen in FOLC_HAEIN.

Residues 8-129 are 74% similar to a (SYNTHASE FOLYLPOLYGLUTAMATE SYNTHETASE) protein domain (PD164066) which is seen in FOLC_HAEIN.

Residues 127-196 are 39% similar to a (SYNTHETASE PROTEOME FOLYL-POLYGLUTAMATE) protein domain (PD358647) which is seen in O13492_NEUCR.



Paralogs:  Local Blast Search
HD1465 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 273 (E-value = 5.9e-07) place HD1465 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)

PDB Hit:
pdb|1FGS| Folylpolyglutamate Synthetase From Lactobacillus C... 143 3e-035

Gene Protein Sequence:
MIKLIEPKATDSLETWLSYLEKSHFKPIDMGLTRIKSVATSLNLLQPAPY
VITVAGTNGKGSTCRLLEVALLKVGYRVGVYSSPHLIRYNERVRIQGELL
ADEQHIQSFTYIQQNKTASLTYFEFSTLSALHLFKQANLDIVILEVGLGG
RLDATNIIDPNLAVITSIDIDHIDFLGDNREAIGREKAGIFRHNIPVIIG
EPNCPESMLAHADALNCQIVRRDVDWSYSLKNNRLYWQNFDGDKYDLPMP
QIPVPNAATAFAALTRLPFTISKQAIYEAVQEAQMPARFQILTDQAFNHF
SGKPPLAQVIIDVGHNPHAARYLAEQLMRLKQAEQKIYVVFSALIDKDLA
GIVTPLATLIDEWHCAGLAGYRGQSGEQLHQKLVNILPKASAYCYQNVPQ
AATYLFEKATEQDIILVFGSFHTIADFLIWLDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAATTAATTGAGCCTAAAGCCACGGATTCTTTAGAAACGTGGCT
TTCCTATTTAGAAAAAAGCCATTTTAAACCCATTGATATGGGGCTAACAC
GTATTAAAAGTGTTGCCACTTCGCTCAATCTTCTCCAGCCTGCGCCTTAT
GTAATCACCGTGGCGGGCACAAATGGTAAAGGTTCTACTTGTCGTTTACT
TGAAGTTGCATTATTAAAAGTAGGCTATCGTGTGGGCGTTTATTCTTCAC
CACATTTAATCCGCTATAATGAAAGAGTACGGATTCAAGGTGAATTATTA
GCAGATGAACAACATATTCAATCGTTTACATATATTCAACAAAATAAGAC
CGCTTCATTAACCTATTTTGAATTTAGTACACTCTCTGCCTTGCACTTAT
TCAAGCAGGCTAATTTAGATATCGTTATTTTAGAAGTTGGGCTTGGTGGG
CGTTTAGATGCCACGAATATTATCGATCCAAACTTGGCGGTCATTACCTC
CATTGACATTGATCATATCGATTTTCTAGGTGATAACCGTGAAGCAATTG
GCCGTGAAAAAGCGGGTATTTTTCGGCATAATATTCCGGTAATTATTGGC
GAACCTAATTGTCCGGAAAGCATGTTAGCGCACGCGGATGCATTAAATTG
TCAAATAGTTAGGCGTGATGTAGATTGGTCATACTCACTGAAAAATAACC
GCTTGTATTGGCAAAACTTTGATGGAGATAAATATGATTTACCTATGCCA
CAAATTCCCGTCCCTAACGCTGCTACAGCATTCGCCGCCTTAACAAGACT
GCCATTTACAATCAGCAAGCAAGCGATATATGAAGCCGTGCAAGAAGCAC
AGATGCCTGCTCGTTTTCAAATATTAACTGATCAGGCATTTAACCATTTT
TCAGGAAAACCGCCGCTTGCTCAAGTGATTATTGATGTTGGGCATAACCC
ACACGCAGCGCGCTATTTAGCTGAACAATTAATGCGTTTGAAGCAAGCGG
AGCAAAAAATTTATGTGGTTTTTAGCGCTTTAATTGATAAAGATTTAGCC
GGTATTGTTACACCATTAGCAACACTCATTGATGAATGGCATTGTGCTGG
TTTAGCCGGATATCGAGGACAATCAGGCGAACAATTGCATCAAAAATTAG
TCAATATTCTACCTAAAGCTAGCGCTTATTGTTATCAAAATGTACCTCAA
GCGGCGACTTATTTATTTGAAAAAGCGACTGAACAAGACATTATTTTGGT
GTTTGGTTCTTTCCATACTATCGCAGATTTTTTAATTTGGTTGGATAAAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy