Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1078 IGR1076 IGR1077 IGR1074 IGR1075 IGR1073 rbfA, - HD1460 truB, - HD1459 nusA, - HD1462 infB,IF2, - HD1461 ackA, - HD1456 nadV, - HD1455 pta, - HD1457 rbfA, - HD1460 truB, - HD1459 nusA, - HD1462 infB,IF2, - HD1461 ackA, - HD1456 nadV, - HD1455 pta, - HD1457 rbfA, - HD1460 truB, - HD1459 nusA, - HD1462 infB,IF2, - HD1461 HD1463 HD1463 ackA, - HD1456 nadV, - HD1455 pta, - HD1457
* Calculated from Protein Sequence

Gene ID: HD1459

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
truB  

Definition:
tRNA pseudouridine synthase B

Gene Start:
1195549

Gene Stop:
1194632

Gene Length:
918

Molecular Weight*:
34146

pI*:
7.10

Net Charge*:
0.32

EC:
4.2.1.70  5.4.99.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Nurse,K., Wrzesinski,J., Bakin,A., Lane,B.G. and Ofengand,J.
Purification, cloning, and properties of the tRNA psi 55 synthase
from Escherichia coli
RNA 1 (1), 102-112 (1995)
Medline: 96079944


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to tRNA pseudouridine synthase B. Residues 1-303 are 71% similar to this enzyme from Pasteurella multocida and residues 1-288 are 73% similar to this enzyme from Haemophilus influenzae Rd (1174805|).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0130
COG name: Pseudouridine synthase
Functional Class: J
The phylogenetic pattern of COG0130 is amtkYqvcebrh----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002501 (Pseudouridylate synthase, TruB family, N-terminus) with a combined E-value of 5.6e-62.
    IPB002501A    22-76
    IPB002501B    133-148
    IPB002501C    174-206
    IPB002501B    121-136


ProDom Summary:  Protein Domain Search
Residues 176-303 are 58% similar to a (SYNTHASE TRNA PSEUDOURIDINE URACIL) protein domain (PD101077) which is seen in TRUB_PASMU.

Residues 13-50 are 86% similar to a (SYNTHASE TRNA PSEUDOURIDINE PROCESSING PSI55 URACIL) protein domain (PD006841) which is seen in TRUB_HAEIN.

Residues 177-302 are 43% similar to a (SYNTHASE TRNA PSEUDOURIDINE URACIL) protein domain (PD035638) which is seen in TRUB_VIBCH.

Residues 51-175 are 81% similar to a (SYNTHASE TRNA PSEUDOURIDINE) protein domain (PD292997) which is seen in TRUB_PASMU.



Paralogs:  Local Blast Search
HD1459 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 30 to 180 (E-value = 1e-83) place HD1459 in the TruB_N family which is described as TruB family pseudouridylate synthase (N terminal domain) (PF01509)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VARPKKKGRDIHGVFLLDKPQGMSSNEVLQKVKRFYQANKAGHTGALDPL
ATGMLPICLGEATKFSQFLLDSDKRYIVTAKLGERTDTSDAEGELVESRE
VSLTEKDILAILPQFTGDLLQVPTMFSALKHQGKPLYEYARQSITIEREA
RPITIFELKFISYEAPYLTLEVHCSKGTYIRTLIDDLGEKLGCGAHVAIL
RRLAVADYPADAMMNYASLQHLSETEALEVLDEYLLPVDTAVRRFPKIKL
TTMQTKAIGFGQRVKFDNLAQIYGMVRLYSEADLFLGIAEITADNVIRPN
RMVNL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTAGACCTAAAAAGAAAGGACGTGATATTCACGGTGTCTTTTTGTT
AGATAAGCCACAGGGTATGTCTTCCAATGAAGTGTTGCAAAAAGTAAAAC
GATTTTACCAAGCCAATAAAGCAGGGCATACAGGTGCATTAGATCCATTA
GCAACTGGTATGTTGCCTATTTGTTTAGGTGAAGCGACCAAATTTTCACA
ATTTTTACTTGATTCAGATAAGCGTTACATTGTTACGGCAAAATTAGGCG
AGCGAACAGATACTTCTGATGCCGAAGGCGAGCTTGTTGAAAGTCGGGAA
GTTAGCCTTACTGAAAAGGATATCTTGGCAATTTTACCACAATTTACGGG
TGATCTTTTACAAGTGCCCACGATGTTTTCTGCTTTAAAACATCAGGGTA
AACCATTATATGAGTATGCTCGTCAAAGCATTACTATTGAGCGTGAAGCT
CGCCCAATTACTATTTTTGAATTGAAGTTTATTAGTTATGAAGCACCTTA
TTTAACATTAGAAGTACATTGTTCAAAAGGTACTTATATTCGAACTTTAA
TTGATGATTTGGGAGAGAAATTAGGCTGTGGTGCACACGTGGCAATATTA
CGACGATTAGCCGTAGCTGATTATCCCGCTGATGCAATGATGAATTATGC
AAGTTTGCAACATTTATCAGAAACAGAAGCGCTTGAAGTATTAGATGAAT
ACCTTTTACCTGTTGATACCGCCGTGAGAAGATTTCCTAAAATTAAGCTA
ACCACTATGCAAACAAAAGCGATTGGTTTTGGACAACGCGTAAAATTTGA
TAATTTGGCACAAATTTATGGTATGGTGCGTTTGTATTCAGAAGCGGATC
TTTTTCTTGGTATCGCAGAAATAACGGCAGATAATGTTATTCGGCCTAAT
CGAATGGTAAACCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy