Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1076 IGR1077 IGR1074 IGR1071 IGR1075 IGR1073 IGR1072 HD1454 rbfA, - HD1460 truB, - HD1459 infB,IF2, - HD1461 HD1453 ackA, - HD1456 nadV, - HD1455 pta, - HD1457 HD1454 rbfA, - HD1460 truB, - HD1459 infB,IF2, - HD1461 HD1453 ackA, - HD1456 nadV, - HD1455 pta, - HD1457 HD1454 rbfA, - HD1460 truB, - HD1459 infB,IF2, - HD1461 HD1453 ackA, - HD1456 nadV, - HD1455 pta, - HD1457
* Calculated from Protein Sequence

Gene ID: HD1457

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pta  

Definition:
phosphotransacetylase

Gene Start:
1192388

Gene Stop:
1194526

Gene Length:
2139

Molecular Weight*:
76761

pI*:
5.20

Net Charge*:
-14.09

EC:
2.3.1.8  

Functional Class:
Central intermediary metabolism; Other  
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Pyruvate metabolism
Taurine and hypotaurine metabolism

Secondary Evidence:
Matsuyama,A., Yamamoto-Otake,H., Hewitt,J., MacGillivray,R.T. and
Nakano,E.
Nucleotide sequence of the phosphotransacetylase gene of
Escherichia coli strain K12
Biochim. Biophys. Acta 1219 (2), 559-562 (1994)
Medline: 95002178


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to phosphotransacetylase from H. influenzae (1172706), E. coli (730416), Deinococcus radiodurans (7473306), among others. HD1457 is 78% similar to residues 1-711 from PTA_HAEIN.

HD1457 is similar to phosphotransacetylase from T. pallidum (TP0094), M. pneumoniae (MP0413), M. genitalium (MG299), and U. urealyticum (UU066). No similarities to C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0280
COG name: Phosphotransacetylase
Functional Class: C
The phylogenetic pattern of COG0280 is ------VcEBrH-jgpol--X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002505 (Phosphate acetyl/butaryl transferase) with a combined E-value of 6.7e-107.
    IPB002505A    508-542
    IPB002505B    551-573
    IPB002505C    583-592
    IPB002505D    616-659
    IPB002505E    676-708


ProDom Summary:  Protein Domain Search
Residues 456-707 are 24% similar to a (PROTEOME COMPLETE PHOSPHOTRANSACETYLASE) protein domain (PD317132) which is seen in Q9PR79_UREPA.

Residues 403-542 are 28% similar to a (TRANSFERASE ACETYLTRANSFERASE) protein domain (PD214254) which is seen in PTA_BORBU.

Residues 175-217 are 67% similar to a (ACETYLTRANSFERASE PHOSPHATE COMPLETE) protein domain (PD228445) which is seen in Q9CMV1_PASMU.

Residues 508-691 are 90% similar to a (TRANSFERASE PHOSPHATE ACYLTRANSFERASE ACETYLTRANSFERASE) protein domain (PD002789) which is seen in Q9KT08_VIBCH.

Residues 219-366 are 66% similar to a (PHOSPHATE TRANSFERASE ACETYLTRANSFERASE) protein domain (PD315729) which is seen in Q9KT08_VIBCH.

Residues 496-532 are 97% similar to a (PHOSPHOTRANSACETYLASE ACETYLTRANSFERASE) protein domain (PD334891) which is seen in PTA_HAEIN.

Residues 2-173 are 68% similar to a (ACETYLTRANSFERASE PHOSPHATE COMPLETE) protein domain (PD329177) which is seen in PTA_HAEIN.

Residues 397-491 are 83% similar to a (TRANSFERASE PHOSPHATE ACETYLTRANSFERASE COMPLETE) protein domain (PD319787) which is seen in PTA_HAEIN.

Residues 548-709 are 50% similar to a (ENZYME OXIDOREDUCTASE MALIC) protein domain (PD386668) which is seen in PTA_TREPA.



Paralogs:  Local Blast Search
HD1457 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 233 to 345 (E-value = 2.5e-47) place HD1457 in the DRTGG family which is described as DRTGG domain (PF07085)
Residues 390 to 706 (E-value = 2.9e-185) place HD1457 in the PTA_PTB family which is described as Phosphate acetyl/butaryl transferase (PF01515)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSRTIILIPITTDVGLTSVSLGLVHALEQKGIKVGFLKPIAQPISGEDKL
DRSTSIIQAAQTTEVGEPLLLSEAELLIGQNQADVLLEKIVERYQQLSKN
NEVIIIEGLIPTRKNSYANSINYDVAQALDAEIILVAAPGSDKPVQLKER
IEAVASEFGGRDNPNLLGVIINKFNAPVDESGRTRPDLTEIFDSFQHSAQ
NIAEVEALFAKSPINLLACIKWKSDLIATRAIDVAKHLHAAIINEGDLHT
RRIRGVSFCACSIPHMVDYFKAGNLLVTSADRPEVLVAASLAVMNGIEIG
AILLTGGYKIDHNVAKLCQQAFETGLPVFRVEGNTWQTALNLQSVSLEVP
VDDKGRIDAIKEYVASQFDAHFVDEVSKVATRVRRLSPAAFRYQLTEYAR
EAKKRIVLPEGDEPRTIKAAALCAKRGIAECVLLANPVDVQRIAEAQGVV
LGKGITIINPEDVSENYVSRLVELRKNKGMTEVVAREQLTDTVVLGTMML
EAGEVDGLVSGAVHTTANTIRPPMQIIKTAPGSSIVSSIFFMLLPDQVLV
YGDCAVNPDPTAEQLAEIAIQSAESAKAFGIDPRVAMISYSTGSSGSGAD
VEKVKEATRIAQEKRPDLIIDGPLQYDAAVMEDVARSKAPNSPVAGKATV
FVFPDLNTGNTTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVY
TIALTAIQATQS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAGGACGATTATTCTTATCCCAATCACAACTGATGTTGGTCTTAC
AAGCGTTAGCTTAGGATTAGTTCATGCATTAGAACAAAAAGGAATTAAAG
TTGGCTTTTTAAAACCTATTGCTCAACCGATTAGCGGTGAAGATAAATTA
GACCGCTCTACTTCAATTATTCAAGCTGCTCAAACAACAGAAGTGGGCGA
GCCACTTCTGTTAAGTGAAGCGGAATTATTAATTGGCCAGAATCAAGCAG
ATGTTTTATTAGAAAAGATTGTTGAGCGTTACCAACAATTGTCTAAAAAT
AATGAAGTGATTATTATTGAAGGGTTAATCCCAACGCGTAAAAATTCATA
CGCAAACAGCATTAATTATGATGTTGCACAAGCATTAGATGCAGAAATTA
TTTTAGTGGCAGCGCCAGGTTCAGATAAACCTGTACAATTAAAAGAACGT
ATAGAAGCGGTTGCATCAGAGTTTGGTGGTCGTGATAATCCTAACTTATT
AGGCGTAATCATTAATAAATTTAATGCGCCTGTAGATGAGTCAGGTCGTA
CTCGCCCAGATCTAACTGAAATTTTTGATTCATTCCAACATAGTGCACAA
AACATTGCAGAAGTAGAAGCACTATTTGCTAAAAGCCCAATTAATTTATT
GGCTTGTATAAAATGGAAATCCGATTTAATTGCAACTCGTGCAATTGATG
TCGCCAAACATTTACATGCCGCCATTATTAATGAAGGTGATTTACACACT
CGCCGTATCCGTGGTGTTTCATTTTGTGCGTGTAGTATTCCGCATATGGT
TGACTACTTTAAAGCGGGTAATTTATTGGTTACTTCTGCCGATCGCCCAG
AAGTATTAGTTGCTGCTTCTTTAGCTGTAATGAATGGTATTGAAATTGGT
GCCATATTATTAACCGGTGGATATAAAATTGATCATAATGTTGCCAAACT
TTGTCAACAAGCGTTTGAAACAGGCTTACCTGTATTCCGTGTTGAAGGAA
ATACTTGGCAAACTGCATTAAATCTACAAAGTGTTAGCTTAGAAGTGCCA
GTAGATGATAAAGGACGTATTGATGCAATTAAAGAATATGTTGCAAGCCA
ATTTGATGCTCACTTTGTGGATGAAGTATCTAAAGTTGCAACGCGTGTAC
GTCGCCTCTCCCCTGCTGCTTTCCGTTATCAATTAACAGAATATGCACGT
GAAGCGAAAAAACGTATTGTACTGCCTGAAGGTGATGAGCCTCGTACTAT
TAAAGCTGCTGCTTTATGTGCGAAACGTGGCATTGCAGAATGTGTACTTT
TAGCTAATCCTGTTGATGTTCAACGTATTGCAGAGGCACAAGGGGTGGTA
TTGGGTAAAGGGATTACCATTATTAATCCGGAAGATGTGAGTGAAAACTA
CGTTTCTCGTTTAGTTGAATTACGTAAAAATAAAGGTATGACGGAAGTAG
TCGCGCGTGAGCAATTAACGGATACCGTAGTGCTGGGTACAATGATGTTA
GAAGCGGGAGAAGTTGATGGCTTAGTGTCCGGTGCAGTACATACCACCGC
AAATACGATCCGTCCACCAATGCAAATCATTAAAACTGCACCAGGTAGCT
CTATTGTTTCTTCTATCTTCTTTATGCTATTACCAGATCAAGTGCTAGTA
TATGGAGACTGTGCCGTAAATCCGGATCCAACAGCGGAACAATTAGCTGA
AATTGCGATCCAATCGGCAGAATCAGCAAAAGCATTTGGCATTGATCCAC
GTGTCGCAATGATTTCTTATTCGACAGGTAGTTCAGGCTCTGGTGCTGAT
GTTGAGAAAGTAAAAGAAGCAACTCGTATTGCTCAAGAAAAGCGCCCAGA
TTTAATTATTGATGGTCCATTACAATATGATGCGGCGGTGATGGAAGATG
TAGCACGTTCTAAAGCGCCTAATTCACCAGTAGCAGGTAAAGCGACTGTC
TTTGTATTCCCTGATTTGAATACAGGTAATACAACGTATAAAGCGGTTCA
ACGTTCTGCTGATTTAGTCTCTATTGGTCCAATGCTACAAGGTATGCGTA
AACCAGTTAATGATCTTTCACGTGGAGCATTAGTTGATGATATTGTGTAC
ACTATTGCATTGACGGCAATTCAAGCTACTCAATCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy