Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1076 IGR1069 IGR1077 IGR1074 IGR1071 IGR1075 IGR1073 IGR1072 IGR1070 HD1454 HD1451 rbfA, - HD1460 truB, - HD1459 HD1452 infB,IF2, - HD1461 HD1453 ackA, - HD1456 nadV, - HD1455 pta, - HD1457 HD1454 HD1451 rbfA, - HD1460 truB, - HD1459 HD1452 infB,IF2, - HD1461 HD1453 ackA, - HD1456 nadV, - HD1455 pta, - HD1457 HD1454 rbfA, - HD1460 truB, - HD1459 HD1452 infB,IF2, - HD1461 HD1451 HD1453 ackA, - HD1456 nadV, - HD1455 pta, - HD1457
* Calculated from Protein Sequence

Gene ID: HD1456

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ackA  

Definition:
acetate kinase

Gene Start:
1191114

Gene Stop:
1192316

Gene Length:
1203

Molecular Weight*:
43812

pI*:
5.20

Net Charge*:
-13.83

EC:
2.7.2.1  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Propanoate metabolism
Pyruvate metabolism

Secondary Evidence:
Kakuda,H., Hosono,K., Shiroishi,K. and Ichihara,S.
Identification and characterization of the ackA (acetate kinase
A)-pta (phosphotransacetylase) operon and complementation analysis
of acetate utilization by an ackA-pta deletion mutant of
Escherichia coli
J. Biochem. 116 (4), 916-922 (1994)
MEDLINE: 95189796

Kirkpatrick C, Maurer LM, Oyelakin NE, Yoncheva YN, Maurer R, Slonczewski JL.
Acetate and formate stress: opposite responses in the proteome of Escherichia coli.
J Bacteriol. 2001 Nov;183(21):6466-77.
PMID: 11591692

Moir-Blais TR, Grundy FJ, Henkin TM.
Transcriptional activation of the Bacillus subtilis ackA promoter requires sequences upstream of the CcpA binding site.
J Bacteriol. 2001 Apr;183(7):2389-93.
PMID: 11244084


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to acetate kinase from H. influenzae (1168303), E. coli (113115), Neisseria meningitidis (7380359), among others. HD1456 is 73% similar to residues 4-399 from ACKA_HAEIN.

HD1456 is similar to acetate kinase from T. pallidum (TP0476), M. pneumoniae (MP0309), M. genitalium (MG357), and U. urealyticum (UU484). No similarities to C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0282
COG name: Acetate kinase
Functional Class:  C
The phylogenetic pattern of COG0282 is ------VcEBrhujgpol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000890 (Acetate and butyrate kinase) with a combined E-value of 1.3e-108.
    IPB000890A    6-17
    IPB000890B    85-95
    IPB000890C    117-129
    IPB000890D    144-165
    IPB000890E    174-187
    IPB000890F    207-245
    IPB000890G    268-279
    IPB000890H    324-335
    IPB000890I    381-390


ProDom Summary:  Protein Domain Search
Residues 5-342 are 75% similar to a (KINASE ACETATE TRANSFERASE ACETOKINASE) protein domain (PD003226) which is seen in ACKA_HAEIN.

Residues 6-164 are 79% similar to a (KINASE ACETATE TRANSFERASE ACETOKINASE) protein domain (PD348124) which is seen in ACKA_PASMU.

Residues 343-396 are 81% similar to a (KINASE ACETATE TRANSFERASE COMPLETE) protein domain (PD135366) which is seen in ACKA_PASMU.



Paralogs:  Local Blast Search


HD1456 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 391 (E-value = 7.2e-232) place HD1456 in the Acetate_kinase family which is described as Acetokinase family (PF00871)

PDB Hit:
pdb|1G99|A Chain A, An Ancient Enzyme: Acetate Kinase From Meth... 300 2e-082

Gene Protein Sequence:
MSQNLILILNCGSSSLKFAILDPINGDEKLSGLAESFYLDDARIKWKFNG
EKGNADLDAGAAHTEALNFIVSNILTDELKQSIGAIGHRIVHGGEKFTSS
VVITDEVVKGIEEVIQFAPLHNPAHLIGIQEAFRIFPELKDRNVAVFDTA
FHTTMPEQAYLYALPYSLYKDHGVRRYGAHGTSHYFVSREAARRLNVAED
KVNVITCHLGNGGSVSAIRHGECIDTSMGLTPLEGLVMGTRSGDIDPAII
FYMHDTLGMSVEEINNTLTKKSGLLGLTEVTSDCRYAEDNYETDDAARRA
MEVYCYRLAKYIGSYMAVIGERLDAIVFTGGIGENSAHVREITLNHLKLF
GYQVDDARNLAARFGNEGVITAEGSPLAMVIATNEELVIAQDTARLTITK
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCAAAATTTAATTCTTATTCTTAATTGTGGTAGCTCATCTTTAAA
ATTTGCTATCTTAGATCCAATAAACGGTGATGAAAAATTGTCCGGTTTAG
CGGAATCTTTTTATTTAGATGATGCACGTATTAAGTGGAAATTTAACGGT
GAAAAAGGTAATGCAGATTTAGATGCGGGAGCTGCACACACTGAAGCTTT
AAACTTCATCGTTTCTAACATTCTTACTGATGAATTAAAACAAAGTATTG
GAGCTATTGGTCACCGTATTGTACACGGTGGCGAGAAATTTACTTCTTCT
GTAGTTATTACTGATGAAGTGGTAAAAGGTATCGAAGAAGTCATTCAATT
TGCACCGCTTCACAATCCTGCGCATTTAATTGGTATTCAAGAAGCATTTC
GTATTTTCCCTGAATTAAAAGATAGAAACGTTGCAGTATTTGATACAGCA
TTCCACACAACTATGCCAGAACAAGCATATTTATATGCCCTACCATACTC
ATTGTATAAAGATCATGGCGTTCGTCGTTATGGGGCACATGGTACAAGCC
ATTATTTTGTAAGCCGTGAAGCAGCAAGACGCTTAAATGTTGCAGAAGAT
AAAGTTAATGTTATTACTTGCCACTTAGGTAATGGTGGATCTGTGTCAGC
AATTCGCCACGGTGAATGTATTGACACTTCTATGGGACTAACGCCATTAG
AAGGTTTAGTGATGGGGACACGTTCGGGTGATATTGATCCTGCCATTATT
TTCTATATGCATGATACGCTCGGCATGTCAGTTGAAGAAATCAATAATAC
GTTAACTAAAAAATCAGGTTTGTTAGGTTTAACAGAAGTTACTAGCGATT
GCCGTTATGCAGAAGATAACTATGAAACTGATGATGCTGCTCGTCGCGCT
ATGGAAGTATATTGCTACCGCTTAGCAAAATATATTGGCTCATATATGGC
AGTAATCGGTGAACGTTTAGATGCTATTGTATTTACTGGCGGTATCGGAG
AAAACTCAGCACACGTGCGTGAAATTACATTAAATCACTTAAAATTATTT
GGTTATCAAGTTGATGATGCACGTAACTTAGCGGCTCGTTTTGGTAATGA
AGGTGTAATTACTGCTGAAGGTTCTCCACTTGCAATGGTAATTGCAACAA
ATGAAGAGTTAGTTATTGCGCAAGATACTGCACGTTTAACAATTACTAAA
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy