Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1068 IGR1069 IGR1074 IGR1067 IGR1071 IGR1064 IGR1073 IGR1072 IGR1065 IGR1066 IGR1070 IGR1063 HD1449 HD1448 HD1454 HD1446 HD1451 HD1444 HD1452 nadV, - HD1445 HD1453 ackA, - HD1456 nadV, - HD1447 nadV, - HD1455 HD1449 HD1448 HD1454 HD1446 HD1451 HD1444 HD1452 nadV, - HD1445 HD1453 ackA, - HD1456 nadV, - HD1447 nadV, - HD1455 HD1448 HD1454 HD1446 HD1444 HD1452 HD1450 HD1451 HD1449 HD1450 nadV, - HD1445 HD1453 ackA, - HD1456 nadV, - HD1447 nadV, - HD1455
* Calculated from Protein Sequence

Gene ID: HD1452

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1187962

Gene Stop:
1186796

Gene Length:
1167

Molecular Weight*:
44740

pI*:
8.90

Net Charge*:
10.47

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two significant hits using gapped BLAST to hypothetical protein from Bacteriophage If1 (6136513) and Pseudomonas sp (94979). HD1452 is 51% similar to residues 3-319 from Y320_BPIF1.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 64-381 are 51% similar to a (ORF320) protein domain (PD182759) which is seen in Y320_BPIF1.



Paralogs:  Local Blast Search
HD1452 is paralogously related to HD1444 (0.0).


Pfam Summary:  Pfam Search
Residues 293 to 383 (E-value = 4.2e-09) place HD1452 in the Phage_X family which is described as Phage X family (PF05155)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LFFIMNYHIDWLTIEQDFGFEIPESILAAIFDFGMVGIHLDTGEMQEGIK
TGKYRHKGSFCDEVSIKVSGSVIKMEGNPSRWGKVENVLGFTDVDSCVAC
FNNILFSLNLPLFTRCTEVFYLQGKEGEKVKKFSNGAIIKRLDITTNKSV
GKGNERTFLKALSQMRYRNSVGRLHTNHCTVDWLSEKGNANLIYPSCYIK
HEEMKLHSYDKIKNKFGQQAKEFQYYQKVFDYCLENGVVRFEQKLKSRYL
QRENLCYWGLSDFSKLNEIQDGFINMYKKLSVSEVKLETIAQQLVSQGVV
DTLRKANTTAYYAMRWSSGEDLSLLPIATFKRHRAILRKIGIDIANPCDI
EKFQAVRVISCEQIFVKPFKAPDFYQYPSNMPQLRLVA$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTTTTATCATGAATTATCACATTGACTGGCTGACAATAGAACAAGA
TTTTGGATTCGAAATCCCTGAGTCCATACTTGCGGCCATCTTTGATTTCG
GCATGGTAGGTATACATTTAGATACAGGTGAAATGCAAGAAGGGATTAAA
ACAGGCAAATACAGACACAAAGGTAGCTTTTGTGATGAAGTTAGCATAAA
AGTTTCTGGCTCAGTGATAAAAATGGAAGGCAACCCCAGTCGTTGGGGTA
AAGTTGAGAATGTACTTGGCTTTACAGATGTCGATTCATGTGTCGCCTGT
TTCAATAACATTTTATTTTCTTTGAATTTACCCCTGTTCACCCGTTGCAC
TGAGGTTTTCTATTTACAAGGTAAAGAGGGTGAGAAAGTTAAAAAGTTTT
CTAACGGCGCAATTATTAAACGCCTGGACATCACAACAAATAAATCTGTC
GGTAAAGGCAATGAGCGCACCTTTCTCAAAGCACTTTCGCAAATGCGTTA
TCGTAATTCTGTTGGAAGATTACACACAAACCACTGCACGGTAGATTGGT
TAAGTGAAAAGGGTAATGCCAATTTAATTTACCCGAGTTGTTATATTAAA
CATGAAGAGATGAAGCTTCATTCTTACGACAAGATAAAAAACAAATTTGG
GCAACAGGCTAAAGAGTTTCAATATTACCAAAAGGTATTTGATTACTGTT
TAGAGAATGGAGTGGTTAGATTTGAACAGAAGTTAAAGTCAAGGTATTTA
CAACGAGAGAATTTGTGTTATTGGGGTTTAAGTGATTTTTCAAAATTAAA
TGAAATTCAAGATGGGTTTATAAACATGTATAAAAAATTAAGCGTAAGTG
AAGTGAAATTAGAAACCATTGCACAACAACTTGTTTCTCAAGGAGTGGTA
GACACTTTACGTAAAGCCAATACCACTGCTTATTATGCAATGCGATGGTC
AAGTGGTGAAGATTTGAGTTTGTTGCCGATTGCAACTTTTAAAAGACACA
GAGCTATTCTTAGAAAAATTGGTATCGACATTGCCAATCCTTGCGACATT
GAAAAATTCCAGGCTGTTCGTGTTATTTCATGTGAACAGATTTTTGTTAA
ACCATTTAAAGCCCCTGATTTTTATCAATATCCAAGCAATATGCCTCAAT
TACGGCTAGTTGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy