Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1059 IGR1056 IGR1058 IGR1061 IGR1062 IGR1067 IGR1060 IGR1064 IGR1065 IGR1066 IGR1055 IGR1057 IGR1063 HD1441 HD1449 HD1448 HD1446 HD1437 HD1443 HD1439 gspD, - HD1436 HD1444 HD1434 nadV, - HD1445 ompP2,ompH, - HD1435 nadV, - HD1447 HD1441 HD1449 HD1448 HD1446 HD1437 HD1443 HD1439 gspD, - HD1436 HD1444 HD1434 nadV, - HD1445 ompP2,ompH, - HD1435 nadV, - HD1447 HD1448 HD1446 HD1437 HD1439 gspD, - HD1436 HD1444 HD1440 HD1442 HD1440 HD1443 HD1449 HD1441 HD1442 nadV, - HD1445 ompP2,ompH, - HD1435 nadV, - HD1447 HD1434
* Calculated from Protein Sequence

Gene ID: HD1443

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1181198

Gene Stop:
1180872

Gene Length:
327

Molecular Weight*:
12310

pI*:
9.10

Net Charge*:
1.71

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 4-108 are 33% similar to 16122498 putative phage protein [Yersinia pestis]. Otherwise, one significant hit using gapped BLAST to helix destabilizing protein, single-stranded DNA binding protein from Bacteriophage I2-2 (138384). HD1443 is 29% similar to residues 1-102 from VHED_BPI22.


No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1443 is paralogously related to HD1451 (1e-60).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRTGFYIVGKLLGQKSTSFTHRETGEVKYKHTIGIQLQDPDGFGGYNTFT
QDLRIDERSVNQGLSSSIERLKGKNVMVLVFPREWAMEGGRKGIIYHFDE
NSVIEEIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTACAGGCTTTTATATTGTTGGTAAATTGTTAGGCCAAAAATCAAC
TAGTTTTACTCATCGTGAAACAGGTGAGGTTAAATACAAGCATACTATCG
GCATTCAATTACAAGACCCAGATGGCTTTGGTGGCTATAACACCTTTACC
CAAGATTTAAGAATTGATGAACGCTCAGTTAATCAAGGACTTTCTTCTAG
CATTGAACGACTAAAAGGTAAAAATGTTATGGTGCTTGTGTTTCCACGCG
AATGGGCAATGGAAGGTGGAAGAAAGGGTATCATTTATCACTTTGACGAA
AACTCAGTGATTGAAGAAATCAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy