Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1059 IGR1056 IGR1058 IGR1061 IGR1062 IGR1060 IGR1064 IGR1065 IGR1055 IGR1057 IGR1063 IGR1054 HD1441 HD1446 HD1437 HD1443 HD1432 HD1439 gspD, - HD1436 HD1444 HD1434 nadV, - HD1445 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 nadV, - HD1447 HD1441 HD1446 HD1437 HD1443 HD1432 HD1439 gspD, - HD1436 HD1444 HD1434 nadV, - HD1445 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 nadV, - HD1447 HD1446 HD1437 HD1432 HD1439 gspD, - HD1436 HD1444 HD1440 HD1442 HD1440 HD1443 HD1441 HD1442 HD1434 nadV, - HD1445 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 nadV, - HD1447
* Calculated from Protein Sequence

Gene ID: HD1437

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1179122

Gene Stop:
1178814

Gene Length:
309

Molecular Weight*:
11392

pI*:
9.40

Net Charge*:
1.93

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 10-102 are 39% similar to 16122502 putative phage-related membrane protein [Yersinia pestis].

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1437 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VVMGTIIKFLANAFSGVLSFIFNTLVIKFFVFGCVFIAVTEIVPILIIEV
FLPEQVNLKSLMSQIPPDIAYFLGFFKLDVGIQSMLSAYTSRFLIRRIPL
VG$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTTATGGGCACTATCATTAAATTCTTAGCCAATGCTTTTTCAGGCGT
TTTATCTTTTATTTTTAATACCCTTGTAATTAAATTCTTTGTTTTTGGTT
GTGTTTTTATTGCCGTCACTGAAATTGTTCCTATATTAATAATTGAGGTC
TTCCTACCTGAGCAGGTTAATTTAAAAAGTCTTATGTCACAAATCCCACC
TGATATTGCTTATTTCTTAGGTTTTTTTAAATTGGATGTTGGCATTCAAT
CTATGCTATCTGCTTACACCTCACGCTTTTTAATCAGACGCATTCCACTT
GTTGGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy