Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1056 IGR1052 IGR1053 IGR1051 IGR1050 IGR1049 IGR1055 IGR1057 IGR1054 HD1432 hlyX,fnr, - HD1427 gspD, - HD1436 HD1434 csrA, - HD1430 uspA, - HD1428 galU, - HD1431 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 alaS, - HD1429 HD1432 hlyX,fnr, - HD1427 gspD, - HD1436 HD1434 csrA, - HD1430 uspA, - HD1428 galU, - HD1431 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 alaS, - HD1429 HD1432 hlyX,fnr, - HD1427 gspD, - HD1436 HD1434 csrA, - HD1430 uspA, - HD1428 galU, - HD1431 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 alaS, - HD1429
* Calculated from Protein Sequence

Gene ID: HD1432

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1174046

Gene Stop:
1173519

Gene Length:
528

Molecular Weight*:
20725

pI*:
10.10

Net Charge*:
7.15

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to unknown protein sequences, e.g.residues 3-165 are 51% similar to an unknown protein sequence in Actinobacillus pleuropneumoniae (3372538|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-82 are 42% similar to a (DOMAIN OF UNKNO N) protein domain (PD392504) which is seen in O85216_ACTPL.

Residues 91-159 are 66% similar to a (PROTEOME COMPLETE PM0990) protein domain (PD177636) which is seen in O85216_ACTPL.



Paralogs:  Local Blast Search
HD1432 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYNFVSQIQQELAIFLPYREKLVTINSALFAKKTQKVTAFMQEIEATALL
LHKQQTEEYLDVYSRKLFQQFEALYKVMIKLKVNNQTENMVFCSSFRFEK
NIQALPPVKRLAEYKKALRALNEKISWLIKMSYTNGNENIQQQMQETEFR
KQKCLKAIDELEEEILILRLNKKGA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATAATTTTGTCAGTCAAATTCAACAAGAATTAGCTATTTTTCTTCC
TTATCGGGAAAAATTGGTGACTATAAATAGCGCCTTATTTGCAAAAAAAA
CACAAAAAGTAACTGCTTTTATGCAAGAAATTGAAGCAACTGCATTGTTA
TTACATAAACAACAAACTGAGGAATATTTAGACGTGTATTCAAGAAAGTT
ATTCCAACAATTTGAAGCTTTATATAAAGTCATGATCAAATTGAAAGTAA
ATAATCAAACTGAAAACATGGTATTTTGTTCATCTTTCCGATTTGAAAAA
AATATCCAGGCTTTACCGCCCGTTAAACGTTTAGCCGAATATAAAAAAGC
ATTACGTGCTTTAAATGAAAAAATCAGTTGGTTAATTAAAATGAGTTACA
CGAATGGCAACGAGAATATTCAACAGCAGATGCAAGAAACAGAGTTTCGT
AAGCAGAAATGTTTGAAAGCTATTGATGAGTTAGAGGAAGAGATATTAAT
ATTACGCTTAAATAAAAAAGGGGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy