Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1056 IGR1052 IGR1053 IGR1051 IGR1048 IGR1050 IGR1049 IGR1055 IGR1057 IGR1054 HD1432 hlyX,fnr, - HD1427 gspD, - HD1436 HD1434 csrA, - HD1430 uspA, - HD1428 galU, - HD1431 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 alaS, - HD1429 HD1432 hlyX,fnr, - HD1427 gspD, - HD1436 HD1434 csrA, - HD1430 uspA, - HD1428 galU, - HD1431 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 alaS, - HD1429 HD1432 hlyX,fnr, - HD1427 gspD, - HD1436 HD1434 csrA, - HD1430 uspA, - HD1428 galU, - HD1431 ompP2,ompH, - HD1435 ompP2,ompH, - HD1433 alaS, - HD1429
* Calculated from Protein Sequence

Gene ID: HD1431

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
galU  

Definition:
UTP-glucose-1-phosphate uridylyltransferase

Gene Start:
1172604

Gene Stop:
1173491

Gene Length:
888

Molecular Weight*:
32505

pI*:
5.80

Net Charge*:
-4.82

EC:
2.7.7.9  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Galactose metabolism
Nucleotide sugars metabolism
Pentose and glucuronate interconversions
Starch and sucrose metabolism

Secondary Evidence:
Weissborn,A.C., Liu,Q., Rumley,M.K. and Kennedy,E.P.
UTP: alpha-D-glucose-1-phosphate uridylyltransferase of Escherichia coli: isolation and DNA sequence of the galU gene and purification of the enzyme
J. Bacteriol. 176 (9), 2611-2618 (1994)
MEDLINE: 94222839

Boels IC, Ramos A, Kleerebezem M, de Vos WM.
Functional analysis of the Lactococcus lactis galU and galE genes and their impact on sugar nucleotide and exopolysaccharide biosynthesis.
Appl Environ Microbiol. 2001 Jul;67(7):3033-40.
PMID: 11425718

Mollerach M, Garcia E.
The galU gene of Streptococcus pneumoniae that codes for a UDP-glucose pyrophosphorylase is highly polymorphic and suitable for molecular typing and
phylogenetic studies.
Gene. 2000 Dec 30;260(1-2):77-86.
PMID: 11137293

Nesper J, Lauriano CM, Klose KE, Kapfhammer D, Kraiss A, Reidl J.
Characterization of Vibrio cholerae O1 El tor galU and galE mutants: influence on lipopolysaccharide structure, colonization, and biofilm formation.
Infect Immun. 2001 Jan;69(1):435-45.
PMID: 11119535

Dean CR, Goldberg JB.
Pseudomonas aeruginosa galU is required for a complete lipopolysaccharide core and repairs a secondary mutation in a PA103 (serogroup O11) wbpM mutant.
FEMS Microbiol Lett. 2002 May 7;210(2):277-83.
PMID: 12044687


Comment:
For the galE sequence, see HD0829.

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 10803043 in GenBank.

Numerous significant hits using gapped BLAST to UTP-glucose-1-phosphate uridyltransferase (UDPGP) from H. influenzae (1169833), E. coli (120929), Klebsiella pneumoniae (2501466), among others. HD1431 is 78% similar to residues 1-295 from GALU_HAEIN.

HD1431 is similar to UTP-glucose-1-phosphate uridyltransferase (UDPGP) from M. pneumoniae (MP0175) and M. genitalium (MG453). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1210
COG name: UDP-glucose pyrophosphorylase
Functional Class:  M
The phylogenetic pattern of COG1210 is -mt--q--EBrhujgpo----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-128 are 72% similar to a (TRANSFERASE COMPLETE PROTEOME BIOSYNTHESIS) protein domain (PD000318) which is seen in GALF_KLEPN.

Residues 61-129 are identical to a (URIDYLYLTRANSFERASE PYROPHOSPHORYLASE) protein domain (PD036351) which is seen in Q9F664_HAEDU.

Residues 130-171 are identical to a (PYROPHOSPHORYLASE URIDYLYLTRANSFERASE) protein domain (PD403675) which is seen in Q9F664_HAEDU.

Residues 10-60 are 76% similar to a (URIDYLYLTRANSFERASE PYROPHOSPHORYLASE) protein domain (PD408709) which is seen in Q46768_ECOLI.

Residues 172-269 are identical to a (TRANSFERASE PYROPHOSPHORYLASE ADP-GLUCOSE) protein domain (PD001252) which is seen in Q9F664_HAEDU.



Paralogs:  Local Blast Search
HD1431 is paralogously related to HD0688 (4e-12).


Pfam Summary:  Pfam Search
Residues 2 to 276 (E-value = 6.4e-12) place HD1431 in the NTP_transferase family which is described as Nucleotidyl transferase (PF00483)

PDB Hit:
pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mecha... 62 6e-011

Gene Protein Sequence:
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIV
FVTHSSKNAIENHFDTSFELETMLEKRVKRQLLDEVRSIVPNDVTLMHVR
QGQAKGLGHAVLCGKAVVGKEPFAVVLPDVILADFTANPKTENLAAMIKR
FSETQCSQIMVAPVPQEDVSNYGIVDCATDNIRAGETAKIAKMVEKPSIE
NAPSNLAIVGRYVFSATIWDLLERTPVGVGDEIQLTDAIDMLIEKETVEA
FHMTGRAFDCGDKLGYMEAFVEYSLRHEKCGQQFQKIIKELAKSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTCATTATTCCTGTTGCAGGCTTAGGAACACGAATGCTTCCGGC
TACTAAAGCCATTCCTAAAGAAATGTTAACTATTGCAGATAAACCACTCA
TTCAATACATTGTCAATGAATGTGTTGCAGCCGGTATTAAAGAAATCGTA
TTCGTGACACACTCATCTAAAAATGCGATCGAAAATCATTTCGACACTTC
TTTTGAATTGGAAACAATGTTGGAAAAACGTGTTAAACGCCAATTGTTAG
ATGAAGTTCGTTCAATTGTACCGAATGATGTTACGTTAATGCATGTTCGC
CAAGGACAAGCAAAAGGATTAGGGCATGCTGTTTTATGCGGTAAAGCGGT
CGTGGGTAAAGAGCCATTTGCAGTTGTTTTACCGGACGTTATTTTGGCTG
ATTTTACCGCTAACCCTAAAACAGAAAATTTGGCCGCTATGATTAAACGT
TTTTCAGAAACCCAATGTAGTCAAATTATGGTTGCACCCGTGCCACAAGA
AGATGTTAGCAATTATGGTATAGTTGATTGTGCGACGGATAACATTCGTG
CAGGAGAAACAGCCAAAATCGCTAAAATGGTTGAAAAACCATCTATTGAG
AATGCCCCTTCTAATCTTGCCATTGTAGGACGCTATGTTTTCTCTGCAAC
TATTTGGGATCTATTAGAACGTACGCCTGTAGGGGTAGGGGATGAAATTC
AATTAACGGATGCGATTGATATGCTGATCGAAAAAGAAACTGTTGAAGCA
TTCCATATGACAGGGCGTGCTTTTGATTGTGGTGATAAATTAGGCTATAT
GGAGGCTTTTGTTGAGTATAGCTTACGCCACGAAAAATGCGGTCAACAAT
TCCAAAAAATCATTAAAGAACTAGCGAAAAGCTTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy