Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1052 IGR1053 IGR1046 IGR1051 IGR1048 IGR1050 IGR1047 IGR1049 IGR1055 IGR1054 purK, - HD1423 purE, - HD1424 HD1432 hlyX,fnr, - HD1427 csrA, - HD1430 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 galU, - HD1431 ompP2,ompH, - HD1433 alaS, - HD1429 purK, - HD1423 purE, - HD1424 HD1432 hlyX,fnr, - HD1427 csrA, - HD1430 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 galU, - HD1431 ompP2,ompH, - HD1433 alaS, - HD1429 purE, - HD1424 HD1432 hlyX,fnr, - HD1427 purK, - HD1423 csrA, - HD1430 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 galU, - HD1431 ompP2,ompH, - HD1433 alaS, - HD1429
* Calculated from Protein Sequence

Gene ID: HD1429

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
alaS  

Definition:
alanyl-tRNA synthetase

Gene Start:
1169724

Gene Stop:
1172348

Gene Length:
2625

Molecular Weight*:
96606

pI*:
6.00

Net Charge*:
-15.26

EC:
6.1.1.7  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Alanine and aspartate metabolism
Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Putney,S.D., Royal,N.J., Neuman de Vegvar,H., Herlihy,W.C.,
Biemann,K. and Schimmel,P.
Primary structure of a large aminoacyl-tRNA synthetase
Science 213 (4515), 1497-1501 (1981)
Medline: 82017165


Comment:


Blast Summary:  PSI-Blast Search
A match in gapped BLAST to a previously submitted sequence in Genbank: residues 92-874 are identical to alanyl-tRNA synthase from Haemophilus ducreyi (10803041|).

Numerous significant hits using gapped BLAST to alanyl-tRNA synthetase from H. influenzae (1174496), E. coli (2507425), Neisseria meningitidis (7380429), among others. HD1429 is 67% similar to residues 1-874 from SYA_HAEIN.

HD1429 is similar to alanyl-tRNA synthetase from C. pneumoniae (CPn0892), C. trachomatis (CT749), U. urealyticum (UU369), M. pneumoniae (MP0422), M. genitalium (MG292), and T. pallidum (TP1017).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0013
COG name: Alanyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0013 is amtKYqVcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003156 (DHHA1 domain) with a combined E-value of 1.6e-198.
    IPB003156A    7-20
    IPB003156B    73-103
    IPB003156C    168-183
    IPB003156D    205-220
    IPB003156E    229-242
    IPB003156F    282-319
    IPB003156G    362-373
    IPB003156H    397-408
    IPB003156I    497-507
    IPB003156J    563-616
    IPB003156K    644-654
    IPB003156L    660-677
    IPB003156C    171-186


ProDom Summary:  Protein Domain Search
Residues 563-681 are identical to a (SYNTHETASE LIGASE AMINOACYL-TRNA ALANYL-TRNA) protein domain (PD001534) which is seen in Q9F666_HAEDU.

Residues 3-266 are 84% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD002561) which is seen in SYA_PASMU.

Residues 825-868 are identical to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD005722) which is seen in Q9F666_HAEDU.

Residues 275-415 are 88% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD002924) which is seen in Q9F666_HAEDU.

Residues 490-556 are identical to a (SYNTHETASE LIGASE ALANYL-TRNA) protein domain (PD002754) which is seen in Q9F666_HAEDU.

Residues 730-811 are 84% similar to a (SYNTHETASE LIGASE ALANYL-TRNA) protein domain (PD372236) which is seen in Q9F666_HAEDU.

Residues 682-729 are identical to a (SYNTHASE ALANYL-TRNA) protein domain (PD379121) which is seen in Q9F666_HAEDU.

Residues 424-473 are 56% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD402776) which is seen in Q9I553_PSEAE.

Residues 416-489 are identical to a (SYNTHASE ALANYL-TRNA) protein domain (PD389404) which is seen in Q9F666_HAEDU.

Residues 682-803 are 30% similar to a (SYNTHETASE LIGASE ATP-BINDING ALARS) protein domain (PD283279) which is seen in SYA_THEMA.

Residues 281-420 are 27% similar to a (SYNTHETASE LIGASE ATP-BINDING ALARS) protein domain (PD398964) which is seen in SYA_MYCGE.



Paralogs:  Local Blast Search
HD1429 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 797 to 868 (E-value = 6.9e-21) place HD1429 in the DHHA1 family which is described as DHHA1 domain (PF02272)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKTTSEIRQSFLDFFNSKGHTVVPSSALVPENDPTLLFTNAGMNQFKDVF
LGLEKRPYTRATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGD
YFKHDAIQFAWEFLTSEKWLHLPKEKLYVTVYETDDEAYDIWHKTVGVPS
EHIIRIGDNKGVPYASDNFWAMGDTGPCGPCTEIFYDHGESFWGGLPGTA
EEDGDRYIEVWNIVFMQFNRQADGTLAKLPKPSVDTGMGLERMTAVMQHV
NSNYETDIFQTLIKEVATLLHVADLDNKSLRVIADHIRACSYLIVDGVIP
SNEGRGYVLRRIIRRAVRHGNLLGAKEAFFYKLVPTLAKVMGQAGEILTD
KQSYIQKTLKTEEEQFARTLERGLALLEEALTKVENQTLSGEVAFKLYDT
YGFPLDLTADVCRERDIVIDEASFEIEMTAQRERAKSSSNFGADYNSVIK
VEAETAFIGYDCFNAEAKVIALFSNGQAVDKVQSGESAVVVLDKTPFYAE
MGGQVGDSGLITTAFCQFAVADTQKYGQVFGHIGQVVSGSLAIGDIISAQ
VDIARRQAITANHSATHLLHSALRQVLGEHVVQKGSLVSENVLRFDFSQS
QAVSKAQLEEIERIVNRQIRQNLAVTIETMDIETAKEKGTVALFGEKYGD
VVRVVGMTDFSIELCGGTHVKHTGEIGLFKLISESAVAAGIRRVEALTAE
NAINWLHNQQKIIHQSAELLKTDSLSLVDKIYQLQDKIKRNEKELQHFKD
KLAAQAGAELAKQVVQINGINVVIQKLEGIESKSLRTMVDDLKNQLSSVI
VVFGSVSADKVNLIVGVTKDLSNKVNAGELVGLIAQQVGGKGGGRPDMAM
AGGTEPQHLDTALAFAKQWIHSKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACAACTTCAGAGATTAGACAATCTTTTTTAGATTTTTTTAATAG
CAAAGGGCATACCGTTGTGCCTAGTAGTGCTTTAGTACCAGAAAATGATC
CAACATTACTTTTTACTAATGCGGGAATGAATCAATTTAAAGACGTTTTT
CTCGGTTTAGAAAAACGTCCTTATACGCGTGCCACAACCGCACAACGTTG
TGTACGTGCTGGCGGAAAACATAATGATCTTGAAAATGTAGGTTATACAG
CACGCCATCATACTTTTTTTGAAATGATGGGCAACTTTAGTTTTGGTGAT
TATTTTAAACATGATGCAATTCAATTTGCGTGGGAATTTCTTACTTCAGA
AAAATGGTTACATTTACCAAAAGAAAAATTATATGTAACTGTTTATGAAA
CTGATGATGAAGCTTATGATATTTGGCATAAAACCGTGGGCGTACCTTCA
GAACATATTATTCGGATCGGCGATAATAAAGGTGTACCTTACGCTTCAGA
TAATTTTTGGGCAATGGGAGATACGGGCCCTTGTGGTCCTTGTACTGAAA
TCTTCTATGATCATGGTGAATCGTTCTGGGGTGGGCTGCCTGGCACCGCT
GAAGAAGATGGTGATCGCTACATTGAAGTGTGGAATATTGTTTTTATGCA
ATTTAACCGTCAAGCAGATGGAACATTAGCCAAGTTACCTAAACCTTCTG
TTGATACCGGTATGGGGTTAGAGCGTATGACTGCGGTGATGCAGCATGTA
AACTCAAACTATGAAACAGATATTTTCCAAACCTTAATTAAAGAAGTTGC
AACATTATTACATGTAGCAGATTTAGATAATAAATCATTACGGGTAATTG
CAGATCATATCCGAGCGTGCTCTTATTTAATTGTAGATGGCGTGATTCCG
TCAAATGAAGGTCGTGGTTATGTATTACGCCGGATTATTCGCAGAGCAGT
AAGGCATGGTAACCTATTAGGTGCTAAAGAAGCATTCTTTTATAAATTAG
TACCTACACTTGCTAAAGTAATGGGGCAAGCGGGTGAAATTTTAACAGAT
AAACAAAGTTATATTCAGAAAACATTAAAAACAGAAGAAGAACAGTTTGC
TCGGACACTTGAGCGAGGCCTTGCGCTATTAGAAGAAGCGTTAACTAAAG
TGGAAAATCAGACACTTTCAGGTGAAGTAGCATTTAAATTGTATGATACT
TATGGCTTCCCATTAGATTTAACCGCAGATGTGTGCCGTGAGCGTGACAT
TGTCATTGATGAGGCGAGTTTCGAAATAGAAATGACCGCTCAACGCGAAC
GCGCAAAATCAAGCAGTAATTTTGGGGCTGATTATAATAGTGTAATTAAA
GTTGAGGCTGAAACAGCCTTTATTGGCTATGATTGCTTTAACGCTGAAGC
AAAAGTAATTGCTTTATTTAGCAACGGACAAGCGGTTGACAAAGTTCAAT
CAGGGGAATCTGCGGTTGTTGTTCTAGATAAAACCCCATTTTATGCAGAA
ATGGGCGGACAAGTTGGCGATAGTGGTTTAATTACTACGGCATTTTGCCA
ATTTGCAGTAGCCGATACACAAAAATACGGTCAAGTATTCGGACATATTG
GGCAAGTAGTGTCGGGTAGTTTAGCAATCGGTGATATTATATCTGCACAA
GTTGATATAGCGCGTCGTCAGGCAATTACGGCTAACCACAGTGCGACACA
TTTATTACATTCTGCATTACGCCAAGTATTAGGTGAGCATGTGGTGCAAA
AAGGATCTTTGGTTTCTGAAAATGTATTACGTTTTGATTTTTCACAATCT
CAAGCGGTCAGTAAAGCCCAATTAGAAGAAATTGAACGAATTGTGAACCG
TCAAATTCGCCAAAACCTCGCGGTTACTATTGAAACGATGGATATTGAAA
CGGCCAAAGAAAAAGGTACTGTTGCATTGTTTGGTGAGAAGTATGGTGAT
GTTGTCCGTGTAGTAGGAATGACCGATTTTTCAATTGAATTATGTGGCGG
TACACATGTAAAACATACCGGTGAAATTGGCTTATTTAAGCTCATCTCTG
AAAGTGCGGTAGCAGCAGGTATAAGACGAGTAGAGGCATTAACGGCAGAA
AATGCAATAAATTGGCTACACAATCAACAAAAAATTATTCATCAAAGTGC
TGAATTACTTAAAACAGATAGCCTTTCATTAGTAGATAAAATCTATCAAT
TGCAAGATAAAATAAAACGTAATGAGAAAGAATTACAACATTTTAAAGAT
AAACTTGCTGCACAAGCAGGTGCTGAATTGGCAAAACAAGTTGTTCAAAT
TAATGGTATTAATGTTGTTATTCAGAAATTAGAAGGTATCGAAAGTAAGT
CATTGCGTACGATGGTCGATGATTTAAAAAATCAATTAAGTAGTGTGATT
GTTGTTTTTGGTAGCGTATCAGCGGATAAAGTTAATTTAATTGTTGGCGT
GACTAAAGATCTTTCCAATAAAGTCAATGCGGGAGAACTTGTAGGACTCA
TTGCTCAACAGGTTGGTGGTAAAGGTGGTGGTCGCCCGGATATGGCAATG
GCTGGCGGAACAGAACCGCAACATTTAGATACTGCACTTGCCTTTGCAAA
ACAGTGGATTCATTCTAAACTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy