Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1046 IGR1042 IGR1043 IGR1048 IGR1044 IGR1040 IGR1041 IGR1050 IGR1045 IGR1047 IGR1049 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 purK, - HD1421 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1422 purK, - HD1423 HD1422 HD1420 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 HD1417
* Calculated from Protein Sequence

Gene ID: HD1424

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purE  

Definition:
phosphoribosylaminoimidazole carboxylase catalytic subunit

Gene Start:
1166772

Gene Stop:
1166284

Gene Length:
489

Molecular Weight*:
17221

pI*:
6.50

Net Charge*:
-1.05

EC:
4.1.1.21  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Tiedeman,A.A., Keyhani,J., Kamholz,J., Daum,H.A. III., Gots,J.S.
and Smith,J.M.
Nucleotide sequence analysis of the purEK operon encoding
5'-phosphoribosyl-5-aminoimidazole carboxylase of Escherichia coli
K-12
J. Bacteriol. 171 (1), 205-212 (1989)
MEDLINE: 89123019

Meyer,E., Leonard,N.J., Bhat,B., Stubbe,J. and Smith,J.M.
Purification and characterization of the purE, purK, and purC gene
products: identification of a previously unrecognized energy
requirement in the purine biosynthetic pathway
Biochemistry 31 (21), 5022-5032 (1992)
MEDLINE: 92287929


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to phosphoribosylaminoimidazole carboxylase catalytic chain from H. influenzae (1172756), E. coli (131627), Pseudomonas aeruginosa (2500012), among others. HD1424 is 66% similar to residues 1-163 from PUR6_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0041
COG name: Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase PurE
Functional Class:  F
The phylogenetic pattern of COG0041 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000031 (1-(5-Phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR) carboxylase) with a combined E-value of 2.1e-61.
    IPB000031A    8-46
    IPB000031B    63-105
    IPB000031C    108-136
    IPB000031C    106-134
    IPB000031C    105-133


ProDom Summary:  Protein Domain Search
Residues 8-154 are 68% similar to a (CARBOXYLASE PHOSPHORIBOSYLAMINOIMIDAZOLE) protein domain (PD002193) which is seen in PUR6_HAEIN.



Paralogs:  Local Blast Search

HD1424 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 161 (E-value = 6.2e-95) place HD1424 in the AIRC family which is described as AIR carboxylase (PF00731)

PDB Hit:
pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucle... 187 7e-049
pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusu... 187 7e-049
pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucle... 213 1e-056

Gene Protein Sequence:
MLQQKAEIAVVMGSKSDWATISEATQILEQFDLAYHVEVVSAHRTPDKLF
SFAESAEQNGYKVIIAGAGGAAHLPGMIAAKTIVPVLGVPVKSSMLNGMD
SLYSIVQMPKGIPVGTLAIGAANAALLAVQILAVFQPELAKKLHAFRQQQ
TQLVLDNPDSRD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACAACAAAAAGCAGAAATTGCGGTCGTAATGGGTTCAAAAAGTGA
CTGGGCAACAATTTCAGAAGCAACACAAATCTTAGAACAATTTGATCTTG
CCTATCATGTCGAAGTAGTATCGGCACATCGGACCCCCGATAAACTATTT
TCGTTTGCTGAATCTGCCGAACAAAATGGCTATAAAGTAATTATTGCAGG
TGCAGGTGGCGCGGCGCATTTGCCGGGTATGATTGCTGCAAAAACAATTG
TACCGGTATTAGGTGTTCCGGTTAAAAGCTCAATGTTAAATGGCATGGAT
AGCTTATATTCTATCGTTCAAATGCCAAAAGGTATTCCAGTTGGAACATT
AGCGATAGGTGCTGCAAATGCTGCACTATTAGCGGTTCAGATTTTAGCTG
TTTTTCAACCTGAATTGGCTAAAAAACTTCATGCCTTTCGGCAACAACAA
ACTCAACTAGTATTAGATAACCCCGATTCACGTGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy