Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1046 IGR1042 IGR1043 IGR1048 IGR1044 IGR1040 IGR1041 IGR1050 IGR1045 IGR1047 IGR1049 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 purK, - HD1421 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1422 purK, - HD1423 HD1422 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429
* Calculated from Protein Sequence

Gene ID: HD1423

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purK  

Definition:
phosphoribosylaminoimidazole carboxylase ATPase

Gene Start:
1166253

Gene Stop:
1165927

Gene Length:
327

Molecular Weight*:
11936

pI*:
4.60

Net Charge*:
-3.77

EC:
4.1.1.21  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Tiedeman,A.A., Keyhani,J., Kamholz,J., Daum,H.A. III., Gots,J.S.
and Smith,J.M.
Nucleotide sequence analysis of the purEK operon encoding
5'-phosphoribosyl-5-aminoimidazole carboxylase of Escherichia coli
K-12
J. Bacteriol. 171 (1), 205-212 (1989)
MEDLINE: 89123019


Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to phosphoribosylaminoimidazole carboxylase ATPase subunit from H. influenzae (1172767), E. coli (2507277), among others. HD1423 is 68% similar to residues 1-106 from PURK_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0026
COG name: Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) PurK
Functional Class:  F
The phylogenetic pattern of COG0026 is ----yqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-83 are 69% similar to a (CARBOXYLASE PHOSPHORIBOSYLAMINOIMIDAZOLE) protein domain (PD037403) which is seen in Q9CN26_PASMU.



Paralogs:  Local Blast Search

HD1423 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1B6R|A Chain A, N5-Carboxyaminoimidazole Ribonucleotide Syn... 106 9e-025
pdb|1B6S|B Chain B, Structure Of N5-Carboxyaminoimidazole Ribon... 106 1e-024

Gene Protein Sequence:
MQKSAIYPSVYVLGNGQLGRMLRYAGAPLDIQVIPLSFDAELVDIEANSI
ITAEIERWDETPLTTLLSNHKNFANLAVFATTADRFSQKSLLDKLQLATS
PWQLVESA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAAAGTGCTATTTACCCTTCAGTTTATGTATTAGGCAACGGTCA
GCTTGGCAGAATGCTACGCTATGCGGGTGCTCCTTTAGATATTCAAGTAA
TACCACTTTCGTTTGATGCTGAACTAGTTGATATTGAAGCAAATAGTATT
ATCACAGCTGAAATAGAGCGCTGGGATGAAACTCCCCTCACTACACTATT
AAGTAATCATAAAAATTTTGCCAATCTAGCGGTCTTTGCTACAACGGCCG
ATCGTTTTAGCCAAAAATCACTATTAGATAAGCTACAATTGGCAACCTCT
CCTTGGCAATTAGTTGAAAGTGCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy