Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1046 IGR1042 IGR1043 IGR1048 IGR1044 IGR1040 IGR1041 IGR1050 IGR1045 IGR1047 IGR1049 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429 purK, - HD1421 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1422 purK, - HD1423 HD1422 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 pepP, - HD1418 uvrB, - HD1416 alaS, - HD1429
* Calculated from Protein Sequence

Gene ID: HD1421

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purK  

Definition:
phosphoribosylaminoimidazole carboxylase ATPase

Gene Start:
1165608

Gene Stop:
1165288

Gene Length:
321

Molecular Weight*:
11839

pI*:
6.90

Net Charge*:
-0.43

EC:
4.1.1.21  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Meyer,E., Leonard,N.J., Bhat,B., Stubbe,J. and Smith,J.M.
Purification and characterization of the purE, purK, and purC gene
products: identification of a previously unrecognized energy
requirement in the purine biosynthetic pathway
Biochemistry 31 (21), 5022-5032 (1992)
Medline: 92287929

Tiedeman,A.A., Keyhani,J., Kamholz,J., Daum,H.A. III., Gots,J.S.
and Smith,J.M.
Nucleotide sequence analysis of the purEK operon encoding
5"-phosphoribosyl-5-aminoimidazole carboxylase of Escherichia coli
K-12.
J. Bacteriol. 171 (1), 205-212 (1989)
Medline: 89123019

Watanabe,W., Sampei,G., Aiba,A. and Mizobuchi,K.
Identification and sequence analysis of Escherichia coli purE and
purK genes encoding 5"-phosphoribosyl-5-amino-4-imidazole
carboxylase for de novo purine biosynthesis
J. Bacteriol. 171 (1), 198-204 (1989)
Medline: 89123018


Comment:
This protein possesses an ATPase activity that is dependent on the presence of AIR (AminoImidazole Ribonucleotide).The association of
PurK and PurE produces an enzyme complex capable of converting AIR to CAIR efficiently under physiological condition.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to phosphoribosylaminoimidazole carboxylase protein sequences,e.g.residues 1-91 are 79% similar to phosphoribosylaminoimidazole carboxylase in Haemophilus influenzae strain Rd KW20 (1172767|).

Residues 1-91 are 64% similar to phosphoribosylaminoimidazole carboxylase in Escherichia coli

COGS Summary:  COGS Search
BeTs to 7 clades of COG0026
COG name: Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) PurK
Functional Class:  F
The phylogenetic pattern of COG0026 is ----yqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 5-65 are 75% similar to a (LIGASE SYNTHETASE CARBOXYLASE COMPLETE PROTEOME) protein domain (PD000180) which is seen in PURK_ECOLI.



Paralogs:  Local Blast Search

HD1421 is paralogously related to HD0548 (2e-11).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1B6S|B Chain B, Structure Of N5-Carboxyaminoimidazole Ribon... 120 5e-029
pdb|1B6R|A Chain A, N5-Carboxyaminoimidazole Ribonucleotide Syn... 120 5e-029

Gene Protein Sequence:
MLTNVMHHLNYVGVIAMECFVVGDKLLINELAPRVHNSGHWTQLGCSISQ
FELHLRALLDLPTPELKPIAPSVMVNLIGIAHSNQWLDVPFHNYIGMENK
FAQGAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCACTAATGTAATGCACCATTTAAATTATGTTGGGGTAATTGCAAT
GGAATGTTTTGTGGTAGGCGATAAATTATTAATTAATGAGCTTGCTCCTC
GTGTCCATAATAGCGGGCACTGGACACAGTTAGGCTGTTCCATCAGCCAA
TTTGAATTACACTTGCGTGCGTTACTTGACTTACCAACGCCCGAACTAAA
ACCCATTGCTCCTAGCGTAATGGTTAATTTAATTGGTATAGCACATTCAA
ATCAGTGGCTTGATGTACCTTTTCACAATTACATTGGTATGGAAAACAAG
TTCGCTCAGGGCGCAAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy