Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1046 IGR1039 IGR1042 IGR1043 IGR1048 IGR1044 IGR1040 IGR1041 IGR1045 IGR1047 IGR1049 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 uvrB, - HD1416 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 uvrB, - HD1416 purK, - HD1421 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1422 purK, - HD1423 HD1422 HD1420 HD1417 sspB, - HD1426 uspA, - HD1428 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 uvrB, - HD1416
* Calculated from Protein Sequence

Gene ID: HD1419

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aspC  

Definition:
aspartate aminotransferase; transaminase A;

Gene Start:
1165026

Gene Stop:
1163836

Gene Length:
1191

Molecular Weight*:
43877

pI*:
5.70

Net Charge*:
-6.19

EC:
2.6.1.1  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Alanine and aspartate metabolism
Alkaloid biosynthesis I
Arginine and proline metabolism
Carbon fixation
Cysteine metabolism
Glutamate metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Tyrosine metabolism

Secondary Evidence:
Kuramitsu,S., Okuno,S., Ogawa,T., Ogawa,H. and Kagamiyama,H.
Aspartate aminotransferase of Escherichia coli: nucleotide sequence of the aspC gene
J. Biochem. 97 (4), 1259-1262 (1985)
MEDLINE: 85289110

Fotheringham,I.G., Dacey,S.A., Taylor,P.P., Smith,T.J.,
Hunter,M.G., Finlay,M.E., Primrose,S.B., Parker,D.M. and
Edwards,R.M.
The cloning and sequence analysis of the aspC and tyrB genes from
Escherichia coli K12. Comparison of the primary structures of the
aspartate aminotransferase and aromatic aminotransferase of E. coli with those of the pig aspartate aminotransferase isoenzymes
Biochem. J. 234 (3), 593-604 (1986)
MEDLINE: 86242111


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to aspartate aminotransferase from H. influenzae (1168262), Neisseria meningitidis (7379442), E. coli (112989), among others. HD1419 is 71% similar to residues 1-396 from AAT_HAEIN.

HD1419 is similar to aromatic amino acid aminotransferase from C. pneumoniae (CPn0740) and C. trachomatis (CT637). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1448
COG name: Aspartate/aromatic aminotransferase
Functional Class:  E
The phylogenetic pattern of COG1448 is ----Y---E--h------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001511 (Aminotransferases class-I) with a combined E-value of 8.1e-14.
    IPB001511A    65-75
    IPB001511B    176-190
    IPB001511C    243-256


ProDom Summary:  Protein Domain Search
Residues 94-251 are 47% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD274500) which is seen in PHHC_PSEAE.

Residues 253-373 are 73% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL ASPARTATE) protein domain (PD382781) which is seen in AAT_HAEIN.

Residues 2-64 are 60% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL) protein domain (PD406569) which is seen in AAT_HAEIN.

Residues 20-251 are 70% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE ASPARTATE) protein domain (PD000504) which is seen in Q9CN25_PASMU.



Paralogs:  Local Blast Search
HD1419 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 80 to 396 (E-value = 2.6e-97) place HD1419 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

PDB Hit:
pdb|1ART| Aspartate Aminotransferase (E.C.2.6.1.1) Complexed... 494 1e-140
pdb|1C9C|A Chain A, Aspartate Aminotransferase Complexed With C... 494 1e-140
pdb|1ASF| Aspartate Aminotransferase (E.C.2.6.1.1) Mutant Wi... 492 3e-140

Gene Protein Sequence:
MFNHIEAALTDPILGLNDAFRADIRKTKTNLGIGVYMNAEGQTPIMNAVK
LAETRLLAEESQKNYLQIDGIAHFNSYTQTLLFGQDADVIQTGRVKTAQS
LGGTGALRIAMEFIKRQTDAKTIWISNPTWPNHNAIAEAVGLTIKNYRYY
NPETNGLDWDNLLADLQQAERGDVVLLHGCCHNPTGIDPTAEQWDKLAIL
SAEKGWLPLFDFAYQGLANGLDEDAYGLRAFAKNHKELLIASSYSKNFGL
YNERVGAFTLVAENAEIANNAFTQIKSIIRVLYSNPAAHGAHTVTTVLAD
DQLRANWIAELSEMRDRIKTMRTKMVQLLAEKGAKKDFSFISDQNGMFSF
SGLTATQVDRLRDEFAIYAVRSGRINVAGLTDDNIEAFCDAVVKVL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAATCATATCGAGGCCGCTCTAACCGATCCAATTTTAGGTTTAAA
TGATGCCTTCCGAGCAGATATTCGAAAAACAAAAACTAATTTGGGCATTG
GTGTGTATATGAATGCCGAAGGTCAGACACCGATTATGAATGCCGTAAAA
TTAGCAGAAACGCGTTTACTTGCTGAAGAATCACAAAAGAATTATCTTCA
GATTGATGGTATCGCACACTTTAATAGTTATACGCAAACCTTATTATTTG
GGCAAGATGCCGATGTTATTCAAACGGGGCGAGTAAAAACAGCACAAAGT
TTAGGTGGCACAGGCGCATTACGTATAGCAATGGAGTTTATTAAGCGCCA
AACTGACGCAAAGACTATTTGGATATCAAACCCAACTTGGCCTAATCATA
ATGCAATTGCTGAAGCGGTTGGCTTAACGATAAAAAACTACCGCTATTAT
AATCCCGAAACTAACGGCTTAGATTGGGATAATCTGTTGGCTGACTTGCA
ACAAGCTGAACGTGGCGATGTAGTGTTATTACACGGTTGTTGCCATAACC
CGACCGGTATCGATCCAACAGCAGAACAGTGGGATAAACTCGCTATACTT
TCAGCTGAAAAAGGCTGGTTACCTTTATTTGATTTCGCTTATCAAGGATT
AGCCAATGGCTTAGATGAAGATGCTTACGGTTTACGTGCATTTGCTAAAA
ACCATAAAGAATTATTAATCGCGAGTTCTTATTCAAAAAATTTTGGTTTA
TATAATGAACGCGTGGGCGCTTTTACTTTAGTGGCAGAAAATGCAGAAAT
AGCAAATAATGCATTTACTCAAATTAAATCGATTATTCGAGTGCTCTATT
CTAATCCAGCGGCACACGGTGCTCATACCGTAACCACCGTATTGGCTGAT
GATCAATTACGCGCAAATTGGATCGCTGAATTAAGTGAGATGCGTGATCG
GATTAAAACGATGCGAACTAAAATGGTTCAATTACTAGCTGAAAAAGGCG
CGAAAAAAGATTTCTCATTTATTTCTGATCAGAATGGTATGTTTTCATTC
AGCGGTTTAACCGCTACACAAGTCGACCGTTTACGTGATGAATTTGCAAT
TTATGCGGTTCGTTCTGGGCGAATAAATGTAGCCGGACTTACTGATGATA
ATATCGAAGCGTTTTGCGATGCTGTAGTAAAAGTACTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy