Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1038 IGR1037 IGR1046 IGR1039 IGR1042 IGR1043 IGR1048 IGR1044 IGR1040 IGR1041 IGR1045 IGR1047 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 HD1413 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 purK, - HD1421 purK, - HD1423 purE, - HD1424 hlyX,fnr, - HD1427 aspC, - HD1419 HD1420 HD1417 sspB, - HD1426 HD1413 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 purK, - HD1421 purE, - HD1424 aspC, - HD1419 HD1422 purK, - HD1423 HD1422 HD1420 HD1417 sspB, - HD1426 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 HD1413
* Calculated from Protein Sequence

Gene ID: HD1418

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pepP  

Definition:
XAA-pro aminopeptidase (X-pro aminopeptidase)

Gene Start:
1162474

Gene Stop:
1163760

Gene Length:
1287

Molecular Weight*:
48579

pI*:
4.70

Net Charge*:
-17.32

EC:
3.4.11.9  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Wilce,M.C., Bond,C.S., Dixon,N.E., Freeman,H.C., Guss,J.M.,
Lilley,P.E. and Wilce,J.A.
Structure and mechanism of a proline-specific aminopeptidase from
Escherichia coli
Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3472-3477 (1998)
Medline: 98188227

Yoshimoto,T., Tone,H., Honda,T., Osatomi,K., Kobayashi,R. and
Tsuru,D.
Sequencing and high expression of aminopeptidase P gene from
Escherichia coli HB101
J. Biochem. 105 (3), 412-416 (1989)
Medline: 89278065


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to Aminopeptidase P II from H. influenzae (1168447), E. coli (4699533,113751), Shigella flexneri (2773347) among others. HD1418 is 60% similar to residues 1-428 from AMPP_HAEIN .

HD1418 is similar to XAA-pro aminopeptidase from U. urealyticum (UU532), C. trachomatis (CT574), M. genitalium (MG324 ), and similar to aminopeptidase P from C. pneumoniae (CPn0813), T. pallidum (TP0569), and similar to pepX X-Pro dipeptidase from M. pneumoniae(MP0371).




COGS Summary:  COGS Search
BeTs to 17 clades of COG0006
COG name: Xaa-Pro aminopeptidase
Functional Class: E
The phylogenetic pattern of COG0006 is amtKYqvcEBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001131 (Proline dipeptidase) with a combined E-value of 3.8e-52.
    IPB001131A    214-234
    IPB001131B    246-267
    IPB001131C    341-353
    IPB001131D    365-378
    IPB001131E    393-411
***** IPB002467 (Methionine aminopeptidase, subfamily 1) with a combined E-value of 3.2e-09.
    IPB002467C    242-270
    IPB002467E    365-377
    IPB002467F    381-411


ProDom Summary:  Protein Domain Search
Residues 14-134 are 56% similar to a (AMINOPEPTIDASE HYDROLASE COMPLETE) protein domain (PD011173) which is seen in AMPP_HAEIN.

Residues 195-314 are 36% similar to a (AMINOPEPTIDASE METHIONINE HYDROLASE MAP COBALT COMPLETE) protein domain (PD000555) which is seen in P95018_MYCTU.

Residues 363-417 are 72% similar to a (AMINOPEPTIDASE COMPLETE PROTEOME DIPEPTIDASE HYDROLASE) protein domain (PD000896) which is seen in AMPP_HAEIN.

Residues 244-352 are 57% similar to a (AMINOPEPTIDASE DIPEPTIDASE COMPLETE PROTEOME HYDROLASE) protein domain (PD289122) which is seen in AMPP_HAEIN.

Residues 159-235 are 72% similar to a (DIPEPTIDASE AMINOPEPTIDASE HYDROLASE XAA-PRO PROTEOME) protein domain (PD335744) which is seen in Q9CKA1_PASMU.



Paralogs:  Local Blast Search
HD1418 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 143 (E-value = 4.3e-49) place HD1418 in the AMP_N family which is described as Aminopeptidase P, N-terminal domain (PF05195)
Residues 340 to 411 (E-value = 3e-24) place HD1418 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:
pdb|1JAW| Aminopeptidase P From E. Coli Low Ph Form 406 3e-114
pdb|1AZ9| Aminopeptidase P From E. Coli 405 5e-114
pdb|1A16| Aminopeptidase P From E. Coli With The Inhibitor P... 405 6e-114

Gene Protein Sequence:
MDLSYLAELPKEEFVAHRQRVFEQMQENSAFIVFTETEKRRNADCNYLFR
PDSYFWYLTGFAEPEAALLLIKQNGQYESSIFVRNKDPLMETWHGYRLGV
DAAAAQLNVDKAFDIEDLSLIFAEKTQNLTACYYAEGIQRWGDPLVNNVF
TEVINWQPMLSEMRLFKSPAELALIQQACHISSLAHIRAMRQTRPNRYEM
EIEGEIQYEFSRFGVRFPAYNSIVASGKNACILHYNENNQVLKDGELLLI
DAGAEFAYYASDITRTFPINGKFSLAQREIYQLVLDAMKAATQYLVPNGS
FKAANQAAMQVMTEGLVRLGILQGDITELLAQQAVRQYYLHGLGHWLGLD
VHDVGDYGMDKDRTLASGMVLTLEPGIYIPIDADVPAQYRGIGVRIEDDL
LITEYGNKNLTCSCPKEIADIEAIMAQK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCTCTCATATTTAGCGGAGTTACCCAAAGAAGAATTTGTTGCACA
CCGTCAACGCGTGTTTGAACAGATGCAAGAAAATTCGGCATTTATTGTCT
TTACTGAAACGGAAAAGCGTCGCAATGCTGATTGCAACTATCTATTTCGC
CCAGACAGCTATTTTTGGTATTTAACCGGTTTTGCAGAGCCTGAAGCGGC
ATTATTGTTGATTAAGCAAAATGGTCAATATGAAAGCAGTATTTTTGTGC
GAAATAAAGATCCGTTAATGGAAACGTGGCATGGTTATCGTCTAGGTGTT
GATGCAGCTGCAGCACAATTGAATGTTGATAAGGCTTTTGATATAGAAGA
TTTATCACTTATTTTCGCAGAAAAAACACAAAATTTAACCGCTTGTTACT
ATGCAGAAGGCATACAACGTTGGGGCGATCCGCTTGTGAATAATGTCTTT
ACTGAAGTCATCAATTGGCAACCTATGCTATCTGAAATGCGATTATTTAA
ATCGCCGGCAGAATTAGCCTTAATCCAACAAGCGTGCCATATTTCCTCAT
TGGCGCATATTAGAGCAATGCGACAAACGCGCCCGAATCGCTATGAAATG
GAAATTGAAGGTGAAATTCAATATGAATTTAGCCGCTTTGGTGTACGTTT
TCCCGCCTATAATTCTATTGTTGCCAGTGGTAAAAACGCCTGTATTTTGC
ACTATAATGAAAATAATCAAGTGTTAAAAGATGGCGAACTATTGTTGATT
GATGCGGGAGCAGAGTTTGCTTATTATGCTAGTGATATTACCCGCACATT
CCCAATTAATGGTAAATTTTCGCTAGCCCAACGTGAGATTTATCAGTTAG
TTTTAGATGCAATGAAAGCAGCAACGCAATATCTTGTGCCAAATGGTTCT
TTTAAAGCAGCTAATCAGGCCGCTATGCAAGTTATGACAGAAGGCTTAGT
ACGCTTAGGCATTTTACAAGGAGATATTACAGAATTATTAGCACAACAAG
CAGTGCGCCAATATTATCTGCATGGTTTAGGGCATTGGTTAGGACTAGAT
GTGCATGATGTAGGTGACTATGGTATGGATAAAGATCGAACACTTGCAAG
TGGAATGGTGCTGACATTAGAGCCTGGAATTTATATTCCTATTGATGCGG
ATGTGCCGGCACAATATCGCGGTATCGGTGTTAGAATTGAAGATGATTTA
TTAATTACCGAATATGGTAATAAGAATTTAACCTGTAGTTGCCCAAAAGA
AATTGCTGATATTGAAGCGATTATGGCACAAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy