Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1038 IGR1037 IGR1046 IGR1039 IGR1042 IGR1043 IGR1044 IGR1040 IGR1041 IGR1045 IGR1047 purK, - HD1421 purK, - HD1423 purE, - HD1424 aspC, - HD1419 HD1420 HD1417 HD1413 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 purK, - HD1421 purK, - HD1423 purE, - HD1424 aspC, - HD1419 HD1420 HD1417 HD1413 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 purK, - HD1421 purE, - HD1424 aspC, - HD1419 HD1422 purK, - HD1423 HD1422 HD1420 HD1417 HD1413 sspA, - HD1425 trpH, - HD1414 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416
* Calculated from Protein Sequence

Gene ID: HD1417

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1162097

Gene Stop:
1162339

Gene Length:
243

Molecular Weight*:
8443

pI*:
10.30

Net Charge*:
5.42

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 4-75 are 47% similar to residues 11-82 of 22985782 hypothetical protein [Burkholderia fungorum].

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1417 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSNKHSSKELGSLAAKILKDPNASKIEKELAGSVLSQTNTDKVTSKELES
KASKVLTSEHCSDTAKSLAGSVLSQSKKSR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAATAAACATAGTTCAAAAGAATTAGGCTCGTTAGCTGCAAAGAT
TTTAAAAGATCCCAATGCTTCTAAAATTGAAAAAGAATTAGCGGGTTCAG
TGTTGTCCCAAACGAATACGGATAAAGTTACTAGTAAAGAATTAGAATCA
AAGGCATCAAAAGTGCTTACTTCGGAACATTGTTCTGATACTGCAAAATC
ATTAGCCGGTTCAGTATTATCGCAATCAAAAAAATCTCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy