Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1038 IGR1037 IGR1039 IGR1034 IGR1042 IGR1035 IGR1040 IGR1041 IGR1036 asnS, - HD1411 HD1417 HD1409 HD1413 trpH, - HD1414 HD1410 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 asnS, - HD1411 HD1417 HD1409 HD1413 trpH, - HD1414 HD1410 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 asnS, - HD1411 HD1417 HD1413 trpH, - HD1414 HD1410 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 HD1409
* Calculated from Protein Sequence

Gene ID: HD1413

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1158471

Gene Stop:
1159070

Gene Length:
600

Molecular Weight*:
23040

pI*:
10.00

Net Charge*:
6.62

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 6-199 are 58% similar to 15602616 unknown [Pasteurella
multocida]. Otherwise, three significant hits using gapped BLAST to hypothetical protein from Neisseria meningitidis (7225926, 7379615) and Campylobacter jejuni (6968687). HD1413 is 48% similar to residues 28-224 from gb|AAF41115.1.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-198 are 53% similar to a (PROTEOME COMPLETE PM0751 NMB0698) protein domain (PD359463) which is seen in Q9CMR1_PASMU.



Paralogs:  Local Blast Search
HD1413 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSERNLPLEYHPFPAILPKSATVAMLGTFPPTSEKRCMEFHYPNFQNDMW
RIMGLLFYKNLDHFRVDQEKRFDPVRIEAFLREKGIALCSSAQTAIRLKG
NASDKDLKIIDAIDMQALLTELPQLKWLFTTGGLATETLLSLLPEKSKLP
KTNEWINYPYTTDRTLYLYRLPSTSRAYPLSLAKKVEAYRQFFVRVGVL$


Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGAACGCAATCTACCATTAGAATATCATCCTTTTCCAGCAATCTT
GCCCAAATCTGCTACAGTGGCAATGTTAGGTACATTTCCACCGACCAGTG
AAAAACGGTGTATGGAATTTCATTATCCAAATTTTCAAAACGATATGTGG
CGGATTATGGGATTGCTTTTTTATAAGAATCTTGATCATTTTCGAGTTGA
TCAAGAAAAACGTTTTGATCCAGTGCGGATTGAAGCGTTTTTAAGAGAAA
AAGGCATTGCACTTTGTTCTTCTGCACAAACTGCCATTCGTTTAAAAGGT
AATGCTTCAGATAAAGATCTGAAAATTATTGATGCGATTGATATGCAAGC
ATTATTAACCGAATTACCACAGCTAAAATGGTTATTTACCACGGGTGGGC
TTGCAACGGAAACCTTATTAAGTTTATTACCTGAAAAGAGTAAATTGCCG
AAAACAAATGAATGGATTAATTATCCTTATACAACGGATAGAACATTATA
TTTATATCGTTTACCATCTACCTCACGCGCTTATCCATTAAGTCTGGCTA
AAAAAGTGGAAGCATATCGCCAATTTTTTGTCAGAGTAGGGGTACTTTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy