Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1038 IGR1037 IGR1033 IGR1039 IGR1034 IGR1035 IGR1040 IGR1041 IGR1036 efp, - HD1407 asnS, - HD1411 HD1408 HD1417 HD1409 HD1413 trpH, - HD1414 HD1410 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 efp, - HD1407 asnS, - HD1411 HD1408 HD1417 HD1409 HD1413 trpH, - HD1414 HD1410 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 efp, - HD1407 asnS, - HD1411 HD1409 HD1413 trpH, - HD1414 HD1410 pepP, - HD1418 sbcB, - HD1412 uvrB, - HD1416 HD1408 HD1417
* Calculated from Protein Sequence

Gene ID: HD1412

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sbcB  

Definition:
exodeoxyribonuclease I

Gene Start:
1156851

Gene Stop:
1158449

Gene Length:
1599

Molecular Weight*:
61173

pI*:
7.00

Net Charge*:
0.00

EC:
3.1.11.1  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Phillips,G.J. and Kushner,S.R.
Determination of the nucleotide sequence for the exonuclease I
structural gene (sbcB) of Escherichia coli K12
J. Biol. Chem. 262 (1), 455-459 (1987)
Medline: 87083489

Sandigursky,M. and Franklin,W.A.
DNA deoxyribophosphodiesterase of Escherichia coli is associated with exonuclease I
Nucleic Acids Res. 20 (18), 4699-4703 (1992)
Medline: 93027182



Comment:
From Genbank:[gi:1169569]
This enzyme also functions as a DNA deoxyribophosphodiesterase that release deoxyribose-phosphate moieties following the cleavage of DNA at an apurinic/apyrimidinic (AP) site by either an AP endonuclease AP lyase.



Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to exodeoxyribonuclease I. Residues 20-490 are 66% similar to this enzyme from Haemophilus influenzae (1169569|) and residues 25-490 are 53% similar to this enzyme from Escherichia coli (462029|).

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 25-432 are 71% similar to a (I EXONUCLEASE EXODEOXYRIBONUCLEASE DNA) protein domain (PD042982) which is seen in EX1_HAEIN.



Paralogs:  Local Blast Search

HD1412 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 26 to 209 (E-value = 2e-25) place HD1412 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:
pdb|1FXX|A Chain A, The Structure Of Exonuclease I Suggests How... 514 1e-146

Gene Protein Sequence:
LPACLCYNINHLICYLSKAMNNDFTFFFYDYESFGINPATDRPAQFAGIR
TDREFNIIGEPVMFYCKQTNDYLPSAEAVMVTGIAPQLCNEKGLSEPEFA
QRIHHEFSQPNTCIIGYNNIRYDDEMTRYTFFRNFYDPYEYCWKNGNSRW
DLLDLVRACYALRPSGIEWPKNEKDEPSFKLEHLTKANAIAHQNAHDAMA
DVYATIEIAKLIKQKQRKLFDFFFENRSKKALEKLIDPAELTPLVHVSGM
LGNYRGNTALIVPLAWHPTNQNAVVVCDLSSDIQGLLNDTAEVLKQRLYT
KRDALAEHESPVPLKLVHLNKCPILAPAKTLLAENAMRLAIDRSQCLLNL
AKLQAQKAVVREKVIEIFNDERIFAPSNNVETTLYDSFFSNGDKNNLAIL
RTLKPEQLAEHGLKFADKRVEPLLFHYRARHFPNTLTRAEQIKWQKYCHQ
QIDAKTEQFSQEIANLFERYADHADKVKLLEDLTAYATQLSQYTLPLPSA
AQKNQLMAELNKVAEQQIDKAIKLDLLKTLIK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCCTGCTTGTCTATGTTATAATATTAATCATTTGATTTGTTATTTGAG
TAAGGCGATGAACAACGATTTTACTTTTTTCTTTTATGATTATGAAAGTT
TCGGCATAAATCCAGCAACTGATCGACCTGCGCAATTTGCGGGTATTCGT
ACGGATAGAGAATTTAATATTATTGGTGAACCGGTAATGTTTTATTGTAA
ACAAACTAATGATTATTTGCCTTCAGCTGAAGCGGTGATGGTAACAGGCA
TTGCACCACAACTCTGTAATGAAAAAGGCTTGTCAGAACCAGAATTTGCT
CAACGTATTCATCACGAATTTAGTCAACCTAATACTTGCATTATTGGTTA
TAACAATATCCGTTATGATGATGAAATGACTCGTTATACGTTTTTTCGTA
ATTTTTATGATCCTTATGAATATTGTTGGAAGAACGGCAATTCCCGTTGG
GATTTACTTGATTTAGTGCGCGCGTGCTATGCATTACGTCCGTCCGGCAT
TGAATGGCCTAAAAATGAAAAAGATGAACCTTCTTTCAAGTTAGAGCATT
TGACGAAAGCAAATGCTATTGCACATCAGAATGCGCACGACGCGATGGCA
GATGTATATGCCACGATTGAAATAGCAAAATTAATTAAGCAAAAACAGCG
CAAATTATTTGACTTCTTTTTTGAAAACAGAAGTAAAAAAGCGCTTGAAA
AATTAATTGATCCGGCCGAGTTAACGCCATTAGTGCATGTCTCAGGTATG
TTAGGTAACTATCGCGGTAATACTGCGTTGATTGTACCTCTTGCTTGGCA
TCCCACGAATCAGAATGCTGTGGTTGTCTGTGACTTATCAAGTGATATAC
AAGGGCTATTAAATGATACTGCGGAGGTGTTAAAACAACGTTTATATACT
AAACGTGATGCTTTAGCTGAACACGAATCTCCAGTGCCGTTGAAGTTAGT
TCATCTAAACAAATGCCCAATTTTAGCGCCAGCTAAAACCTTATTAGCAG
AAAATGCAATGCGTTTGGCGATTGATCGTTCACAATGCTTGCTAAATTTA
GCCAAGTTACAAGCACAAAAAGCAGTCGTTCGAGAGAAAGTGATTGAAAT
ATTCAACGATGAGCGTATTTTTGCGCCTTCAAACAACGTAGAAACGACGT
TATACGACAGTTTTTTTTCAAATGGGGATAAAAACAACTTAGCTATTTTA
CGTACATTAAAACCAGAACAACTCGCTGAGCATGGTTTAAAATTTGCAGA
TAAACGTGTAGAACCGTTGTTATTCCACTATCGAGCAAGGCATTTCCCAA
ATACATTAACGCGGGCAGAGCAGATTAAATGGCAGAAATATTGCCATCAA
CAAATTGATGCAAAAACGGAGCAATTTAGTCAGGAAATTGCAAACTTATT
TGAGCGTTATGCTGATCACGCAGACAAAGTAAAATTATTAGAAGATCTGA
CCGCTTATGCGACACAGCTTTCACAATATACATTGCCTTTACCAAGCGCT
GCTCAAAAGAACCAATTAATGGCAGAACTGAATAAAGTGGCAGAGCAACA
GATTGATAAGGCAATAAAACTTGACTTGTTGAAAACATTAATTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy