Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1038 IGR1032 IGR1037 IGR1033 IGR1039 IGR1034 IGR1035 IGR1031 IGR1036 HD1405 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1408 HD1409 HD1413 trpH, - HD1414 HD1410 sbcB, - HD1412 uvrB, - HD1416 HD1405 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1408 HD1409 HD1413 trpH, - HD1414 HD1410 sbcB, - HD1412 uvrB, - HD1416 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1405 HD1409 HD1413 trpH, - HD1414 HD1410 sbcB, - HD1412 uvrB, - HD1416 HD1408
* Calculated from Protein Sequence

Gene ID: HD1411

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
asnS  

Definition:
asparaginyl-tRNA synthetase (asnS)

Gene Start:
1156424

Gene Stop:
1155009

Gene Length:
1416

Molecular Weight*:
53135

pI*:
5.80

Net Charge*:
-7.73

EC:
6.1.1.22  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Alanine and aspartate metabolism
Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Anselme,J. and Hartlein,M.
Asparaginyl-tRNA synthetase from Escherichia coli has significant
sequence homologies with yeast aspartyl-tRNA synthetase
Gene 84 (2), 481-485 (1989)
Medline: 90128294

Aoki,H., Yaworsky,P.J., Patel,S.D., Margolin-Brzezinski,D.,
Park,K.S. and Ganoza,M.C.
The asparaginyl-tRNA synthetase gene encodes one of the
complementing factors for thermosensitive translation in the
Escherichia coli mutant strain, N4316
Eur. J. Biochem. 209 (2), 511-521 (1992)
Medline: 93049293


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to asparaginyl-tRNA synthetase from H. influenzae (1174536), E. coli (135159), Synechocystis PCC6803 (1711644), among others. HD1411 is 83% similar to residues 8-477 from SYN_HAEIN.

HD1411 is similar to asparaginyl-tRNA synthetase from T. pallidum (TP0609), U. urealyticum (UU365), M. genitalium (MG113), M. pneumoniae (MP0580), and similar to lysyl-tRNA synthetase (UU062), from C. trachomatis (CT781), from C. pneumonia (CPn0931), and to aspartyl-tRNA synthetase (TP0985), (MP0108), (CT542), (CPn0662), and (MG036).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0017
COG name: Aspartyl/asparaginyl-tRNA synthetases
Functional Class: J
The phylogenetic pattern of COG0017 is amtKY--ceb-h--gpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 422-464 are 51% similar to a (SYNTHETASE LIGASE ATP-BINDING ASNRS) protein domain (PD406040) which is seen in SYN_HUMAN.

Residues 330-420 are 94% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD110921) which is seen in Q9CN06_PASMU.

Residues 22-138 are 73% similar to a (LIGASE SYNTHETASE BIOSYNTHESIS) protein domain (PD023126) which is seen in Q9CN06_PASMU.

Residues 141-227 are 88% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD190230) which is seen in Q9CN06_PASMU.

Residues 228-304 are 89% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD000871) which is seen in SYN_HAEIN.

Residues 430-467 are 81% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000848) which is seen in SYN_ECOLI.

Residues 21-136 are 40% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD381092) which is seen in SYN_BORBU.

Residues 424-464 are 60% similar to a (LIGASE SYNTHETASE ATP-BINDING ASNRS) protein domain (PD374631) which is seen in SYNM_YEAST.

Residues 22-133 are 31% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD359580) which is seen in O96198_PLAFA.

Residues 424-470 are 51% similar to a (SYNTHETASE SYNC2 ASPARAGINYL-TRNA) protein domain (PD411211) which is seen in Q9SW95_ARATH.



Paralogs:  Local Blast Search


HD1411 is paralogously related to HD1318 (1e-11) and HD0599 (1e-09).


Pfam Summary:  Pfam Search
Residues 25 to 105 (E-value = 1.4e-17) place HD1411 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 122 to 467 (E-value = 2.6e-171) place HD1411 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

PDB Hit:
pdb|1B8A|A Chain A, Aspartyl-Trna Synthetase >gi|4388837|pdb|1B... 165 9e-042
pdb|1EOV|A Chain A, Free Aspartyl-Trna Synthetase (Asprs) (E.C.... 118 1e-027
pdb|1ASZ|A Chain A, Aspartyl Trna Synthetase (Asprs) (E.C.6.1.1... 118 1e-027

Gene Protein Sequence:
LRYSMSKFPTVSEILSGKIVVGEKVTVRGWVRTRRDSKAGLSFLTVYDGS
CFEPIQVIINNDLANYQTEILRLTAGCSVIVTGNIVESPASGQAVELQAL
EVEVVGWVDDPDTYPMAAKRHSIEYLREVAHLRPRTNLIGAVARVRHCLA
QAIHRFFNGQGFYWVATPLITASDTEGAGEMFRVSTLDLENLPRTEHGKI
DYSQDFFGKEAFLTVSGQLNGESYACALSKVYTFGPTFRAENSNTTRHLA
EFWMVEPEFAFATLADNAKLAEDMLKYVFKAVLEERKDDMQFFAKHIDKE
VITRLENFIAAPFAQVDYSDAIEILLKSGKKFEFPVAWGVDLSSEHERFL
AEEHFKSPVVVKNYPKDIKAFYMRLNDDGKTVAAMDVLAPGIGEIIGGSQ
REERLAVLDSRMIEMGLNPEDYWWYRDLRKYGTVPHAGFGLGFERLIVYV
TGLQNIREVIPFPRAPRNANF$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGGTATTCAATGTCTAAATTTCCAACAGTTTCAGAAATCCTATCTGG
CAAAATTGTAGTGGGTGAAAAAGTGACTGTACGTGGTTGGGTACGTACTC
GCCGTGACTCAAAAGCGGGGTTATCATTTTTAACAGTCTATGATGGTTCT
TGTTTTGAACCAATTCAAGTAATTATTAACAATGACTTAGCTAATTATCA
AACAGAAATATTACGTTTAACGGCAGGTTGCTCAGTAATTGTAACAGGAA
ACATTGTTGAATCGCCGGCAAGCGGTCAAGCGGTCGAATTACAAGCACTA
GAGGTAGAAGTTGTAGGTTGGGTTGATGATCCAGATACTTACCCTATGGC
CGCTAAACGCCACTCTATTGAATATCTCCGTGAAGTAGCACATTTACGTC
CTCGCACTAACTTAATTGGCGCGGTAGCACGTGTCCGTCACTGTTTAGCA
CAAGCCATTCATCGTTTCTTTAATGGACAAGGCTTCTATTGGGTTGCTAC
ACCATTAATTACCGCCTCAGATACTGAAGGCGCCGGTGAAATGTTCCGTG
TTTCAACCTTAGATTTAGAAAACTTGCCACGAACAGAACACGGTAAAATA
GATTATAGCCAAGATTTCTTTGGTAAAGAGGCATTCTTGACCGTTTCAGG
CCAACTAAATGGTGAAAGCTATGCTTGTGCATTAAGTAAAGTCTATACTT
TTGGTCCGACTTTCCGAGCAGAAAATTCAAATACGACTCGCCATTTGGCT
GAATTTTGGATGGTTGAACCTGAATTCGCGTTTGCAACTTTAGCAGATAA
CGCAAAATTAGCTGAAGATATGTTGAAATATGTATTTAAAGCGGTGTTAG
AAGAACGTAAAGATGATATGCAATTTTTTGCAAAACATATTGATAAAGAA
GTGATTACACGCTTAGAGAATTTCATTGCTGCACCTTTTGCTCAAGTTGA
TTATAGTGATGCGATTGAGATTCTCTTAAAATCCGGCAAAAAATTTGAAT
TTCCTGTCGCTTGGGGCGTTGATCTTTCTTCTGAACACGAACGTTTCCTT
GCCGAAGAACATTTTAAATCCCCTGTCGTGGTAAAAAACTATCCAAAAGA
TATTAAAGCATTTTATATGCGTTTAAATGATGATGGTAAAACCGTAGCCG
CAATGGATGTATTAGCACCAGGTATTGGTGAGATTATCGGTGGTTCACAA
CGTGAAGAACGTTTAGCTGTATTAGATTCGCGTATGATAGAAATGGGACT
TAATCCTGAAGATTATTGGTGGTATCGTGATTTACGTAAATATGGAACGG
TTCCGCATGCAGGCTTTGGCTTAGGTTTTGAGCGCTTAATTGTTTATGTT
ACCGGCTTACAAAATATCCGTGAAGTGATTCCATTCCCACGCGCGCCGCG
CAATGCAAATTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy