Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1032 IGR1037 IGR1033 IGR1034 IGR1029 IGR1035 IGR1028 IGR1031 IGR1030 IGR1036 HD1405 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1408 HD1403 HD1409 HD1413 HD1401 HD1410 sbcB, - HD1412 slt, - HD1400 HD1405 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1408 HD1403 HD1409 HD1413 HD1401 HD1410 sbcB, - HD1412 slt, - HD1400 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1405 HD1409 HD1413 HD1401 HD1410 sbcB, - HD1412 slt, - HD1400 HD1402 HD1403 HD1408 HD1402
* Calculated from Protein Sequence

Gene ID: HD1409

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1153274

Gene Stop:
1153846

Gene Length:
573

Molecular Weight*:
19649

pI*:
10.50

Net Charge*:
8.13

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-170 are 38% similar to 15603314 unknown [Pasteurella
multocida]. Otherwise, no significant matches at this time.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-170 are 33% similar to a (PROTEOME PM1449 COMPLETE) protein domain (PD399589) which is seen in Q9CL00_PASMU.



Paralogs:  Local Blast Search
HD1409 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKKLITFSAIIALSFATLAEAKGGRSMGGRSFSVTGKPLATKKAPATKMN
HQQKDATFANTPAQTQSAPASANNGNRLASFATGAAAGYLLSDMLTPNAQ
ASQTTTTTQTANEANTSATPAVASAQNNAKMAEFKSIGGQIDPYLVEKTD
GYRRYCIAGVQYLASVQGSQSAPIVMVNPNGSPLQCNLLP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACTTATTACATTTTCAGCTATTATCGCTCTTTCTTTTGCTAC
ACTTGCGGAAGCCAAAGGTGGCCGTTCTATGGGCGGAAGATCATTTTCAG
TAACAGGCAAGCCATTAGCGACTAAAAAAGCGCCTGCTACAAAGATGAAT
CACCAACAAAAAGATGCTACTTTTGCTAACACACCTGCTCAAACACAATC
AGCACCAGCATCAGCAAACAATGGTAACCGTTTAGCAAGTTTTGCAACAG
GTGCAGCAGCAGGTTATTTATTAAGTGATATGCTTACACCAAATGCACAA
GCAAGCCAAACCACTACAACTACGCAAACGGCGAATGAAGCAAATACATC
CGCAACACCAGCGGTCGCTTCTGCGCAAAATAATGCAAAAATGGCTGAAT
TTAAAAGCATTGGCGGTCAAATTGATCCGTATCTAGTTGAGAAAACAGAT
GGCTACCGTCGCTATTGTATCGCAGGCGTACAATATTTAGCATCAGTGCA
GGGCAGTCAATCAGCACCAATTGTAATGGTTAATCCAAACGGATCTCCGT
TACAATGTAACTTATTACCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy