Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1032 IGR1033 IGR1034 IGR1029 IGR1027 IGR1035 IGR1028 IGR1031 IGR1030 HD1405 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1408 HD1403 hpt, - HD1399 HD1409 HD1401 HD1410 slt, - HD1400 HD1405 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1408 HD1403 hpt, - HD1399 HD1409 HD1401 HD1410 slt, - HD1400 efp, - HD1407 asnS, - HD1411 glnS, - HD1404 HD1405 hpt, - HD1399 HD1409 HD1401 HD1410 slt, - HD1400 HD1402 HD1403 HD1408 HD1402
* Calculated from Protein Sequence

Gene ID: HD1404

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glnS  

Definition:
glutaminyl-tRNA synthetase

Gene Start:
1152258

Gene Stop:
1150588

Gene Length:
1671

Molecular Weight*:
63887

pI*:
5.60

Net Charge*:
-12.78

EC:
6.1.1.18  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glutamate metabolism

Secondary Evidence:
Uemura,H., Conley,J., Yamao,F., Rogers,J. and Soll,D.
Escherichia coli glutaminyl-tRNA synthetase: a single amino acid
replacement relaxes rRNA specificity
Protein Seq. Data Anal. 1 (6), 479-485 (1988)
Medline: 89113343

Yamao,F., Inokuchi,H., Cheung,A., Ozeki,H. and Soll,D.
Escherichia coli glutaminyl-tRNA synthetase. I. Isolation and DNA
sequence of the glnS gene
J. Biol. Chem. 257 (19), 11639-11643 (1982)
Medline: 83007236

Hoben,P., Royal,N., Cheung,A., Yamao,F., Biemann,K. and Soll,D.
Escherichia coli glutaminyl-tRNA synthetase. II. Characterization
of the glnS gene product
J. Biol. Chem. 257 (19), 11644-11650 (1982)
Medline: 83007237


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to glutaminyl-tRNA synthetase from H. influenzae (1174538), E. coli (135166), Neisseria meningitidis (7674349), among others. HD1404 is 85% similar to residues 18-557 from SYQ_HAEIN.

HD1404 is similar to glutamyl-tRNA synthetase from C. pneumoniae (CPn0560), C. trachomatis (CT445), M. genitalium (MG462), M. pneumoniae (MP0164), and U. urealyticum (UU599). No similarities to T. pallidum.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class: J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 411-552 are 28% similar to a (SYNTHETASE LIGASE ATP-BINDING) protein domain (PD017811) which is seen in SYQ_SCHPO.

Residues 280-324 are 95% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD228053) which is seen in SYQ_PASMU.

Residues 35-232 are 77% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA GLUTAMYL-TRNA) protein domain (PD001595) which is seen in SYQ_NEIMA.

Residues 339-536 are 79% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD004693) which is seen in SYQ_HAEIN.

Residues 233-279 are 97% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD336317) which is seen in SYQ_HAEIN.

Residues 173-232 are 93% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD335808) which is seen in SYQ_PASMU.



Paralogs:  Local Blast Search


HD1404 is paralogously related to HD0320 (5e-17).


Pfam Summary:  Pfam Search
Residues 32 to 344 (E-value = 3.2e-179) place HD1404 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)
Residues 346 to 533 (E-value = 2.4e-97) place HD1404 in the tRNA-synt_1c_C family which is described as tRNA synthetases class I (E and Q), anti-codon binding domain (PF03950)

PDB Hit:
pdb|1EUQ|A Chain A, Crystal Structure Of Glutaminyl-Trna Synthe... 860 0.0
pdb|1QTQ|A Chain A, Glutaminyl-Trna Synthetase Complexed With T... 860 0.0
pdb|1QRU|A Chain A, Glutaminyl-Trna Synthetase Mutant I129t Com... 859 0.0

Gene Protein Sequence:
MSEETLTTEVETRTNFITHIIDEDLASGKHNNVYTRFPPEPNGYLHIGHA
KSICLNFGIAQEYHGKCNLRFDDTNPVKEDIEYVASIKQDVEWLGFKWQG
EPRYASDYFDQLHGYAIELIEKGLAYVDELSPEEMREYRGTLTEAGKNSP
YRDRSIAENLALFEKMKNGEFKEGTACLRAKIDMASPFIVMRDPVLYRVK
FAHHHQTGDKWCIYPMYDFTHCISDAIERITHSLCTLEFQDNRRLYDWVL
ENISIERPLPHQYEFSRLNLEGTLTSKRKLLQLVTDGIVDGWNDPRMPTI
SGLRRRGYTPASLREFCRRIGVTKQDNVVEYAALEACIREDLNENAPRAM
AVINPVRVVIENVAEPEILKAPNHPNRPELGERDLPFTREIYIDEADFRE
EANKQYKRLVLGKEVRLRNAYVIKAERVEKDASGKITTIFCSYDPETLGK
NPADGRKVKGVIHWVSATQNKVAEFRIYNRLFNVANPGDEEDINAVINPS
SLIVKHGFVEVNLANAQKEQGYQFEREGYYCLDSKEGSADNLIFNLTVSL
KEGFTA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGAAGAAACTTTAACAACTGAGGTTGAAACTAGGACCAATTTTAT
TACTCATATTATTGATGAAGATTTAGCCAGTGGTAAACATAATAATGTTT
ATACTCGTTTCCCACCAGAACCAAATGGTTATTTACATATCGGCCACGCT
AAATCAATCTGTTTAAACTTTGGTATCGCTCAAGAATATCATGGCAAATG
TAATTTACGTTTTGATGATACTAACCCTGTTAAAGAAGACATTGAATATG
TTGCGTCAATTAAACAAGATGTTGAATGGTTAGGCTTTAAGTGGCAAGGT
GAGCCACGCTATGCCTCAGATTATTTTGATCAATTACATGGCTATGCCAT
TGAATTAATTGAAAAAGGATTAGCTTACGTTGATGAGCTATCGCCAGAAG
AAATGCGCGAATATCGTGGTACGCTCACTGAAGCGGGTAAAAATAGCCCA
TATCGCGACCGCAGTATTGCTGAAAACTTAGCATTATTCGAGAAAATGAA
AAATGGTGAGTTTAAAGAAGGTACAGCTTGTTTAAGAGCCAAAATTGATA
TGGCTTCTCCTTTCATTGTAATGCGAGATCCTGTTCTTTACCGTGTTAAA
TTTGCACATCATCACCAAACTGGCGATAAATGGTGTATTTATCCAATGTA
TGATTTCACACATTGTATTTCAGATGCGATTGAACGCATTACGCACTCAC
TTTGTACACTTGAATTCCAAGATAATCGCCGTTTATATGATTGGGTATTA
GAGAATATTTCGATTGAACGCCCATTACCACATCAATATGAATTTTCACG
CTTAAATTTGGAAGGCACATTAACTTCAAAACGTAAATTGTTACAATTAG
TCACAGATGGAATTGTCGATGGTTGGAATGATCCACGTATGCCCACCATT
TCAGGCTTACGTCGACGCGGCTATACTCCGGCTTCTCTGCGTGAATTTTG
TCGCCGAATTGGCGTTACCAAACAAGATAATGTTGTTGAATACGCTGCGT
TAGAAGCCTGTATTCGTGAAGACTTAAATGAGAATGCTCCGCGTGCAATG
GCGGTAATTAATCCTGTACGTGTAGTTATTGAAAACGTTGCTGAACCAGA
AATATTAAAAGCACCAAACCATCCTAATCGACCAGAGCTAGGCGAACGTG
ATCTACCTTTTACCCGTGAAATATATATCGATGAAGCAGATTTCCGTGAA
GAAGCCAATAAGCAATATAAGCGTTTAGTCTTAGGTAAAGAGGTTCGTTT
ACGCAATGCCTATGTTATTAAAGCAGAACGTGTTGAAAAAGATGCAAGCG
GTAAAATTACTACTATTTTTTGTAGTTATGATCCTGAAACATTAGGCAAA
AACCCTGCAGACGGTCGTAAAGTCAAAGGCGTTATTCATTGGGTTTCTGC
GACACAAAATAAAGTTGCTGAATTTCGGATTTATAACCGCTTGTTTAATG
TAGCAAATCCCGGAGATGAAGAAGATATTAATGCAGTGATAAATCCATCT
TCATTAATCGTTAAACATGGTTTTGTTGAAGTTAATTTGGCAAATGCTCA
AAAAGAACAAGGCTATCAATTTGAACGGGAAGGCTATTATTGTTTAGACA
GTAAAGAGGGTTCAGCCGATAACTTAATCTTTAACTTAACCGTTAGCCTA
AAAGAAGGTTTTACGGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy