Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1032 IGR1024 IGR1025 IGR1029 IGR1026 IGR1027 IGR1023 IGR1028 IGR1031 IGR1030 HD1405 efp, - HD1407 glnS, - HD1404 HD1395 HD1403 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 slt, - HD1400 bisC, - HD1394 HD1405 efp, - HD1407 glnS, - HD1404 HD1395 HD1403 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 slt, - HD1400 bisC, - HD1394 efp, - HD1407 glnS, - HD1404 HD1405 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 slt, - HD1400 bisC, - HD1394 HD1397 HD1402 HD1403 HD1397 HD1395 HD1402
* Calculated from Protein Sequence

Gene ID: HD1400

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
slt  

Definition:
soluble lytic murein transglycosylase

Gene Start:
1146711

Gene Stop:
1148855

Gene Length:
2145

Molecular Weight*:
83289

pI*:
9.10

Net Charge*:
6.85

EC:
3.2.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism
Nucleotide sugars metabolism

Secondary Evidence:
Engel,H., Kazemier,B. and Keck,W.
Murein-metabolizing enzymes from Escherichia coli: sequence
analysis and controlled overexpression of the slt gene, which
encodes the soluble lytic transglycosylase
J. Bacteriol. 173 (21), 6773-6782 (1991)
MEDLINE: 92041559

Betzner,A.S. and Keck,W.
Molecular cloning, overexpression and mapping of the slt gene
encoding the soluble lytic transglycosylase of Escherichia coli
Mol. Gen. Genet. 219 (3), 489-491 (1989)
MEDLINE: 90158510


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to probable soluble lytic murein transglycosylase from H. influenzae (1173448), E. coli (134540), Neisseria meningitidis (7227208), among others. HD1400 is 54% similar to residues 175-593 from SLT_HAEIN.

HD1400 is similar to soluble lytic murein transglycosylase from T. pallidum (TP0043). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. genitalium, or M. pneumoniae.



COGS Summary:  COGS Search
BeTs to 9 clades of COG0741
COG name: Soluble lytic murein transglycosylase and related regulatory proteins
Functional Class:  M
The phylogenetic pattern of COG0741 is -----QVcEB-HUJ--oL--x
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000189 (SLT domain) with a combined E-value of 1e-11.
    IPB000189A    574-598
    IPB000189B    615-629


ProDom Summary:  Protein Domain Search
Residues 549-687 are 71% similar to a (PROTEOME COMPLETE TRANSGLYCOSYLASE MUREIN) protein domain (PD003175) which is seen in SLT_HAEIN.

Residues 294-548 are 45% similar to a (SOLUBLE LYTIC TRANSGLYCOSYLASE MUREIN) protein domain (PD042587) which is seen in SLT_HAEIN.



Paralogs:  Local Blast Search


HD1400 is paralogously related to HD2002 (3e-06).


Pfam Summary:  Pfam Search
Residues 551 to 670 (E-value = 1.4e-28) place HD1400 in the SLT family which is described as Transglycosylase SLT domain (PF01464)

PDB Hit:
pdb|1QSA|A Chain A, Crystal Structure Of The 70 Kda Soluble Lyt... 256 5e-069
pdb|1SLY| Complex Of The 70-Kda Soluble Lytic Transglycosyla... 256 5e-069
pdb|1QSA|A Chain A, Crystal Structure Of The 70 Kda Soluble Lyt... 839 0.0

Gene Protein Sequence:
LDNIMWNKTLLTLAMISPFAVATHSHIDKKAHIKTYSEADVKQLEAEWQA
KFAHQLQAKQEQHTARLQQREYFLQIESILKAASAQKQLTAEALYLSKKL
IDVLGDYPLKVDAEWLLLNTKFSLEQATDEDLQAFKQKYPDSPYQQRLNQ
LMFERLYQQQKFSALLAYAKTIAPENADNQCRVFSAQYQQFMAQQQNKEA
QQNSKKTIWLATMMQDLLAQFEKMWLKTAELPQHCADIEQYWRDQGRKTD
ENIRLKAVELAKQNAKKGFEILDQHHQNSELSDWLVEVSKLTANVKYLPT
FVEMQLLTTPNKALILAFFPKFIKTLSETLAQPNFDTYQAWADKWQLSTD
ELREWKIAFISRLFDNQDPNFNIWRDKQLSEIQTDSLIERRIRMALWQQQ
PLAQWLALLSSKAQEKAEWRYWLAKTEQNQQKQFDLFTALSKERGFYPLL
AAQQLSKSYTVKLPIAMALTQQQLAEFQPKLDYISEWRAINRFDNAKSIW
LAWLKTLSFEQQLALSDYAKQQDWYDLAVEATIQAKAWDYLALRLPQAYS
QWFDLHLTEQGVSKTFAMAIARQESAWSPQAKSSADAIGLMQMLPSTAKL
TAQNRGLPFTHNADLLDPFKNIMLGIAHLNELNEKYPNNRILIAAAYNAG
ANRVDKWLARSNGKLNMDEFIASIPFFETRGYVQNVLAYDYYYQILQNHA
NKKAFLAEELKRKY$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGATAATATTATGTGGAATAAGACATTATTAACATTAGCTATGATTAG
CCCTTTTGCTGTTGCGACACATTCGCATATTGATAAAAAAGCACACATAA
AAACATATAGTGAGGCAGACGTAAAACAACTTGAAGCAGAGTGGCAAGCT
AAATTTGCCCATCAATTACAGGCTAAACAAGAACAACACACCGCACGACT
ACAACAACGAGAATATTTTCTGCAAATAGAATCTATTTTAAAAGCAGCTA
GCGCACAAAAGCAATTAACCGCTGAAGCCTTATATCTCAGTAAAAAATTA
ATAGATGTGTTAGGCGATTATCCATTAAAAGTTGATGCTGAGTGGTTATT
GCTCAATACTAAATTCTCGTTAGAGCAAGCAACAGATGAAGATTTACAGG
CTTTTAAGCAAAAATATCCGGACTCACCTTATCAACAGCGCTTAAATCAA
TTAATGTTTGAGCGTTTATATCAGCAACAAAAATTTTCAGCATTATTAGC
TTATGCGAAAACCATTGCACCGGAAAATGCTGATAATCAATGTCGTGTTT
TTTCTGCGCAATATCAGCAATTTATGGCACAACAACAGAATAAAGAAGCT
CAGCAAAACAGCAAAAAAACGATTTGGTTAGCCACTATGATGCAGGATTT
ATTGGCACAATTTGAGAAAATGTGGTTAAAAACAGCAGAATTACCACAGC
ACTGTGCGGATATTGAACAATATTGGCGGGATCAAGGTAGAAAAACCGAT
GAAAATATCAGATTAAAAGCGGTTGAATTAGCTAAGCAAAATGCTAAAAA
AGGCTTTGAAATTTTGGATCAACATCATCAAAATTCGGAGTTAAGCGATT
GGTTGGTAGAAGTCAGCAAATTAACGGCAAATGTCAAATATTTGCCAACT
TTTGTTGAAATGCAACTGCTTACCACACCCAATAAAGCGCTTATATTAGC
TTTTTTTCCAAAATTTATTAAAACCCTTTCAGAAACATTAGCACAACCTA
ACTTTGATACTTATCAAGCATGGGCAGATAAATGGCAGTTAAGCACGGAT
GAACTGCGGGAGTGGAAAATTGCGTTTATTAGTCGTTTATTTGACAATCA
AGATCCAAACTTTAATATTTGGCGGGATAAACAACTATCAGAAATACAAA
CAGATAGCTTGATTGAACGCCGGATTAGAATGGCACTCTGGCAACAACAG
CCATTAGCACAATGGTTAGCGTTACTTTCGAGTAAAGCGCAAGAAAAAGC
AGAATGGCGTTATTGGTTAGCTAAAACAGAACAAAATCAGCAAAAACAGT
TTGATTTATTCACAGCGTTAAGCAAAGAGCGTGGCTTTTATCCGCTATTA
GCGGCACAACAATTATCTAAAAGTTATACAGTTAAATTACCAATTGCGAT
GGCACTTACTCAACAACAGTTAGCGGAATTTCAACCAAAGTTAGATTATA
TTAGTGAATGGCGAGCAATTAATCGGTTTGATAATGCTAAATCCATTTGG
TTAGCGTGGTTGAAAACATTATCCTTTGAACAACAATTAGCATTAAGTGA
TTATGCTAAGCAGCAAGATTGGTATGATTTAGCCGTAGAAGCCACGATTC
AAGCAAAGGCATGGGATTATCTCGCGTTACGTTTACCACAAGCCTATTCT
CAATGGTTCGATCTACATTTAACTGAACAAGGGGTCAGTAAAACCTTTGC
AATGGCAATCGCTAGACAAGAAAGTGCTTGGAGTCCACAAGCAAAATCAT
CAGCAGATGCGATTGGATTAATGCAAATGTTACCCAGTACAGCTAAGTTA
ACTGCACAAAATCGCGGATTACCATTCACACATAATGCAGATCTACTCGA
TCCGTTTAAAAATATTATGTTAGGTATTGCGCACTTAAATGAACTAAATG
AGAAATATCCCAATAATCGTATTTTGATTGCAGCCGCGTATAATGCAGGT
GCAAATAGAGTGGATAAATGGTTGGCGCGTAGTAATGGTAAATTAAATAT
GGATGAATTTATCGCCTCTATTCCATTTTTTGAAACACGCGGTTATGTAC
AGAATGTGCTTGCCTATGATTATTATTATCAAATTTTACAAAATCATGCT
AATAAAAAAGCTTTTTTAGCGGAAGAATTGAAGCGAAAATACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy