Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1024 IGR1025 IGR1029 IGR1026 IGR1027 IGR1023 IGR1028 IGR1030 glnS, - HD1404 HD1395 HD1403 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 slt, - HD1400 bisC, - HD1394 glnS, - HD1404 HD1395 HD1403 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 slt, - HD1400 bisC, - HD1394 glnS, - HD1404 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 slt, - HD1400 bisC, - HD1394 HD1397 HD1402 HD1403 HD1397 HD1395 HD1402
* Calculated from Protein Sequence

Gene ID: HD1399

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hpt  

Definition:
hypoxanthine phosphoribosyl transferase (HPRT)

Gene Start:
1146083

Gene Stop:
1146622

Gene Length:
540

Molecular Weight*:
20375

pI*:
5.00

Net Charge*:
-5.37

EC:
2.4.2.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Showalter,R.E. and Silverman,M.R.
Nucleotide sequence of a gene, hpt, for hypoxanthine
phosphoribosyltransferase from Vibrio harveyi
Nucleic Acids Res. 18 (15), 4621 (1990)
Medline: 90356428


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to hypoxanthine phosphoribosyltransferase from H. influenzae (1170358), Vibrio harveyi (123503), E. coli (547671), among others. HD1399 is 68% similar to residues 1-179 from HPRT_HAEIN.

HD1399 is similar to hypoxanthine-guanine phosphoribosyltransferase from U. urealyticum (UU104), M. pneumoniae (MP0170), and M. genitalium (MG458). No similarities to C. trachomatis, C. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0634
COG name: Hypoxanthine-guanine phosphoribosyltransferase
Functional Class: F
The phylogenetic pattern of COG0634 is -----qv-ebrh--gp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 2.9e-07.
    IPB002375B    94-109


ProDom Summary:  Protein Domain Search
Residues 9-84 are 38% similar to a (PHOSPHORIBOSYLTRANSFERASE) protein domain (PD003271) which is seen in HPRT_BUCAI.

Residues 9-156 are 64% similar to a (TRANSFERASE PHOSPHORIBOSYLTRANSFERASE) protein domain (PD000249) which is seen in HPRT_VIBHA.

Residues 136-179 are 81% similar to a (HYPOXANTHINE TRANSFERASE) protein domain (PD234806) which is seen in Q9CPC6_PASMU.



Paralogs:  Local Blast Search
HD1399 is paralogously related to HD1181 (4e-05).


Pfam Summary:  Pfam Search
Residues 4 to 151 (E-value = 4.1e-36) place HD1399 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1HGX|A Chain A, Hypoxanthine-Guanine-Xanthine Phosphoribosy... 118 4e-028
pdb|1TC2|B Chain B, Ternary Substrate Complex Of The Hypoxanthi... 112 3e-026
pdb|1TC1|B Chain B, A 1.4 Angstrom Crystal Structure For The Hy... 112 3e-026

Gene Protein Sequence:
MKKHHIESLISRKEVQTRIAELAEQINNHYQQTNCQNLVVVGLLRGSFMF
MADLVRLIDIPVEVDFMTVSSYGSSTESSRDVKILKDLEGEINGKDVLIV
EDIIDTGFTLNKVRDILRLRDPRSVSICTLLDKPSRREVAVPVEWVGFAI
PDEFVVGYGIDYAQKYRNLDFIGKVVMDE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACATCATATTGAATCACTTATTTCACGTAAAGAAGTTCAAAC
ACGTATTGCAGAATTAGCTGAACAAATTAATAACCATTATCAGCAAACAA
ATTGTCAGAATTTAGTCGTAGTTGGATTATTAAGGGGTTCTTTTATGTTT
ATGGCGGATCTTGTTCGTTTAATTGATATACCGGTAGAAGTTGATTTTAT
GACCGTGTCTAGTTATGGTTCTAGCACAGAATCCTCGCGTGATGTGAAAA
TTTTAAAAGATTTAGAGGGTGAAATTAACGGCAAAGATGTGTTAATTGTG
GAAGATATTATTGATACAGGCTTTACGCTTAATAAAGTTCGCGACATTTT
ACGTTTGCGTGATCCACGTTCAGTCTCAATTTGTACATTATTAGATAAAC
CGTCTCGCAGAGAAGTCGCTGTGCCGGTTGAATGGGTTGGTTTTGCTATT
CCAGATGAGTTTGTTGTAGGTTATGGTATTGATTATGCACAAAAATATCG
TAACTTAGACTTTATTGGTAAAGTTGTGATGGATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy