Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1024 IGR1025 IGR1029 IGR1026 IGR1027 IGR1023 IGR1028 IGR1022 IGR1030 glnS, - HD1404 HD1395 HD1403 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 torC, - HD1393 slt, - HD1400 bisC, - HD1394 glnS, - HD1404 HD1395 HD1403 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 torC, - HD1393 slt, - HD1400 bisC, - HD1394 hpt, - HD1399 HD1401 dapB, - HD1398 HD1396 torC, - HD1393 slt, - HD1400 bisC, - HD1394 HD1397 HD1402 HD1403 HD1397 HD1395 HD1402
* Calculated from Protein Sequence

Gene ID: HD1398

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dapB  

Definition:
dihydrodipicolinate reductase

Gene Start:
1145195

Gene Stop:
1146004

Gene Length:
810

Molecular Weight*:
29137

pI*:
5.70

Net Charge*:
-4.73

EC:
1.3.1.26  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Liu,L. and Shaw,P.D.
Characterization of dapB, a gene required by Pseudomonas syringae
pv. tabaci BR2.024 for lysine and tabtoxinine-beta-lactam
biosynthesis
J. Bacteriol. 179 (2), 507-513 (1997)
MEDLINE: 97144537


Comment:
For other "dap" genes, see HD1107 (dapA), HD0026 (dapF), HD0630 (dapD), HD0642 (dapE).

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to dihydrodipicolinate reductase from H. influenzae (1169218), E. coli (118242),Pseudomonas syringae (2833447), among others. HD1398 is 73% similar to residues 3-270 from DAPB_HAEIN.

HD1398 is similar to Dihydrodipicolinate Reductase from C. pneumoniae (CPn1047), and C. trachomatis (CT364). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0289
COG name: Dihydrodipicolinate reductase
Functional Class: E
The phylogenetic pattern of COG0289 is amt--qvcebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000846 (Dihydrodipicolinate reductase) with a combined E-value of 9.6e-77.
    IPB000846A    3-14
    IPB000846B    70-102
    IPB000846C    117-132
    IPB000846D    148-167
    IPB000846E    206-243


ProDom Summary:  Protein Domain Search
Residues 204-264 are 80% similar to a (BIOSYNTHESIS REDUCTASE) protein domain (PD008377) which is seen in DAPB_PASMU.

Residues 3-192 are 75% similar to a (BIOSYNTHESIS DIHYDRODIPICOLINATE) protein domain (PD004105) which is seen in DAPB_HAEIN.



Paralogs:  Local Blast Search
HD1398 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 125 (E-value = 7.6e-58) place HD1398 in the DapB_N family which is described as Dihydrodipicolinate reductase, N-terminus (PF01113)
Residues 128 to 265 (E-value = 1.3e-74) place HD1398 in the DapB_C family which is described as Dihydrodipicolinate reductase, C-terminus (PF05173)

PDB Hit:
pdb|1ARZ|D Chain D, Escherichia Coli Dihydrodipicolinate Reduct... 337 9e-094

Gene Protein Sequence:
MLRIAIVGAGGRMGRNLIQAVQQTEGLSLMAAFEREGSSLIGTDVGELVG
ISPLGITISACLAEKTADFDVLIDFTRPEATLEYLKFCLANDKKIVIGTT
GFDENGKQAIKQASQKIAIVFASNYSVGVNLVFKLLEKAAKVMGNYCDIE
IIEAHHKHKVDAPSGTALSMGEHIAKTLGRDLKTDAVFERYGIMDERQTN
QIGFATIRAGDIVGEHSVWFVDEGERVEISHKATSRMTFAKGAVCAAQWL
ANQPQGLFDMTNVLALDQL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAGAATTGCGATTGTGGGCGCGGGTGGTCGTATGGGGCGTAATTT
AATTCAAGCGGTTCAACAAACCGAAGGCTTGAGTTTAATGGCTGCTTTTG
AACGGGAAGGCTCTAGCTTAATTGGCACAGATGTGGGTGAGCTTGTAGGG
ATTTCTCCTCTTGGCATCACAATTAGTGCGTGTTTGGCAGAAAAAACCGC
TGATTTTGACGTGCTAATTGATTTTACTCGACCTGAGGCAACACTAGAGT
ATCTGAAATTCTGTTTAGCCAATGATAAAAAAATCGTGATTGGTACAACC
GGTTTTGATGAAAATGGCAAACAAGCTATTAAACAAGCCTCACAAAAAAT
AGCCATTGTTTTTGCTTCTAATTATAGTGTGGGCGTTAATCTTGTATTCA
AATTACTTGAAAAAGCGGCTAAAGTGATGGGAAATTATTGCGATATTGAG
ATTATTGAAGCCCATCATAAACATAAAGTTGATGCACCATCAGGGACGGC
ATTATCAATGGGTGAACATATTGCAAAAACATTAGGTCGTGATTTAAAAA
CGGATGCAGTGTTTGAACGATACGGTATTATGGATGAACGGCAAACTAAT
CAGATTGGTTTTGCAACGATTCGAGCAGGTGATATAGTAGGCGAGCATTC
TGTTTGGTTTGTTGATGAAGGTGAGCGGGTTGAAATTAGCCATAAAGCCA
CAAGCCGAATGACCTTTGCCAAAGGCGCAGTGTGTGCAGCACAATGGTTA
GCCAATCAACCGCAAGGTTTGTTTGATATGACGAATGTATTAGCATTAGA
TCAGCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy