Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1010 IGR1015 IGR1011 IGR1012 IGR1013 IGR1009 IGR1014 HD1386 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1386 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1386 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1381 HD1381 HD1379
* Calculated from Protein Sequence

Gene ID: HD1384

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argA  

Definition:
N-acetylglutamate synthetase

Gene Start:
1130796

Gene Stop:
1132109

Gene Length:
1314

Molecular Weight*:
49303

pI*:
8.10

Net Charge*:
5.83

EC:
2.3.1.1  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Brown,K., Finch,P.W., Hickson,I.D. and Emmerson,P.T.
Complete nucleotide sequence of the Escherichia coli argA gene
Nucleic Acids Res. 15 (24), 10586 (1987)
Medline: 88096590

Rajagopal,B.S., DePonte,J. 3rd, Tuchman,M. and Malamy,M.H.
Use of inducible feedback-resistant N-acetylglutamate synthetase
(argA) genes for enhanced arginine biosynthesis by genetically
engineered Escherichia coli K-12 strains
Appl. Environ. Microbiol. 64 (5), 1805-1811 (1998)
Medline: 98247316


Comment:
For other "arg" genes, see HD1033 (argH), HD1204 (argG), HD0892 (argD), HD0262 (argR), HD0890 (argC), HD0891 (argB).

Blast Summary:  PSI-Blast Search
Residues 1-437 are 71% similar to 15602693 ArgA [Pasteurella
multocida]. Otherwise, many significant hits using gapped BLAST to N-acetylglutamate synthetase from E. coli (114135), Neisseria meningitidis (7227134), Pseudomonas aeruginosa (114136), among others. HD1384 is 58% similar to residues 5-442 from ARGA_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0548
COG name: Acetylglutamate kinase
Functional Class: E
The phylogenetic pattern of COG0548 is amtkyqvcEbr----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 378-432 are 61% similar to a (N-ACETYLGLUTAMATE SYNTHASE PROTEOME) protein domain (PD404151) which is seen in Q9CMJ6_PASMU.

Residues 335-375 are 80% similar to a (PROTEOME COMPLETE N-ACETYLGLUTAMATE) protein domain (PD405451) which is seen in Q9CMJ6_PASMU.

Residues 274-334 are 77% similar to a (SYNTHASE TRANSFERASE N-ACETYLGLUTAMATE) protein domain (PD022539) which is seen in Q9CMJ6_PASMU.

Residues 337-406 are 54% similar to a (PROTEOME COMPLETE SYNTHASE TRANSFERASE) protein domain (PD207706) which is seen in ARGA_PSEAE.

Residues 23-273 are 70% similar to a (KINASE ACETYLGLUTAMATE TRANSFERASE NAG AGK ARGININE) protein domain (PD003894) which is seen in Q9CMJ6_PASMU.

Residues 5-53 are 53% similar to a (AMINO-ACID N-ACETYLGLUTAMATE NAGS) protein domain (PD249810) which is seen in ARGA_PSEAE.



Paralogs:  Local Blast Search
HD1384 is paralogously related to HD0891 (5e-17).


Pfam Summary:  Pfam Search
Residues 23 to 262 (E-value = 5.2e-07) place HD1384 in the AA_kinase family which is described as Amino acid kinase family (PF00696)
Residues 331 to 407 (E-value = 2e-07) place HD1384 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRNTELIEWFRQSAPYVNMHRHKTFVIMLDGNAIAHPNFINITNDISLLH
SLGIKLVIVFGARCQIENLLKQNNISSSYHHNIRVTDSNMLEIIKQAVGG
LHYDIFSRLSLRLPHSPVLNVVSSNAILAQPLGVIDGVDYGLSGKIRRIN
IEAIQQQLAQNAIVVIGPIAPSVTGKMFNLAFEEIATQLAIKLKVDKLIA
FCDRQGLLDEQGKVISDIHPREAKQHLKKFIQQGDYHHSAARFLQAAIDV
CHAGIKRSHLISYQTDGSLLQELFSRDGVGTQLSEASSECIRLATSFDIA
GLLNLIRPLEDQGLLVKRSREQLEMEISQYTIIERDGIVIACAALIHYPA
EKMAEMACVAVHPDYRDSARGDILLEAIKRRAYKLNIEKLFVLTTQTIQW
FQERGFVQIQPTDLPVEKQRHYNYQRMSKVLMLALDN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTAATACAGAATTAATTGAATGGTTCAGGCAATCAGCGCCATACGT
TAATATGCACAGACATAAAACTTTTGTCATTATGCTTGATGGTAACGCAA
TTGCACATCCAAATTTTATTAATATTACCAACGATATTAGTTTATTACAT
AGTTTAGGGATTAAATTAGTAATTGTGTTTGGGGCCCGTTGTCAAATTGA
AAACTTGTTAAAGCAAAATAATATTTCTTCAAGTTATCATCATAATATTC
GTGTTACAGACAGCAATATGCTTGAAATCATTAAACAAGCTGTGGGTGGC
TTACATTATGATATTTTCTCCCGCTTATCGCTTAGGTTACCCCATTCACC
GGTGCTGAATGTAGTCAGCAGTAATGCTATTCTTGCCCAACCGCTTGGTG
TGATTGACGGCGTAGATTATGGCTTGAGTGGTAAAATTAGACGGATTAAT
ATTGAGGCCATTCAACAGCAATTAGCGCAAAATGCAATTGTCGTGATTGG
TCCAATAGCGCCATCAGTAACCGGAAAAATGTTTAATTTGGCGTTTGAAG
AAATTGCGACTCAATTAGCCATCAAACTTAAAGTGGATAAATTAATAGCC
TTTTGCGACCGCCAAGGATTACTAGACGAACAGGGTAAGGTCATTTCAGA
TATTCACCCGCGTGAAGCCAAACAACATTTAAAAAAATTTATTCAGCAAG
GTGATTATCACCATTCTGCCGCGCGTTTTTTACAAGCGGCGATAGATGTT
TGCCATGCAGGCATTAAACGCTCACATTTAATCAGTTATCAAACGGATGG
TTCTTTGTTGCAAGAGTTATTTTCACGTGATGGCGTTGGTACTCAGCTAT
CCGAAGCAAGCTCAGAATGTATTCGACTTGCCACATCATTTGATATTGCT
GGTTTATTGAATTTAATTCGCCCGTTAGAGGATCAAGGTCTTTTAGTCAA
ACGTTCACGTGAACAATTAGAAATGGAAATTAGCCAATATACGATTATTG
AACGTGATGGTATTGTAATTGCTTGCGCAGCTTTGATACATTATCCCGCT
GAGAAAATGGCAGAAATGGCTTGTGTTGCCGTACATCCTGATTATCGTGA
TTCTGCGAGAGGCGATATTTTACTAGAAGCGATTAAACGACGCGCCTATA
AATTAAATATTGAAAAATTATTTGTATTAACTACCCAAACAATACAATGG
TTTCAAGAACGAGGTTTTGTGCAAATACAACCAACGGATTTACCCGTTGA
AAAACAACGCCATTATAATTATCAACGTATGTCAAAAGTATTAATGTTGG
CATTGGATAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy