Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1010 IGR1015 IGR1011 IGR1012 IGR1013 IGR1009 IGR1014 HD1386 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1386 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1386 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1381 HD1381
* Calculated from Protein Sequence

Gene ID: HD1383

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroF  aroA  

Definition:
3-phosphoshikimate 1-carboxyvinyltransferase

Gene Start:
1129394

Gene Stop:
1130701

Gene Length:
1308

Molecular Weight*:
47857

pI*:
5.20

Net Charge*:
-7.29

EC:
2.5.1.19  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Tatum,F.M., Briggs,R.E. and Halling,S.M.
Molecular gene cloning and nucleotide sequencing and construction
of an aroA mutant of Pasteurella haemolytica serotype A1
Appl. Environ. Microbiol. 60 (6), 2011-2016 (1994)
MEDLINE: 94304176

Parish T, Stoker NG.
The common aromatic amino acid biosynthesis pathway is essential in Mycobacterium tuberculosis.
Microbiology. 2002 Oct;148(Pt 10):3069-77.
PMID: 12368440


Comment:
For other "aro" genes, see HD1274 (aroC), HD1475 (aroG), HD0415 (aroE), HD0422 (aroB), HD0423 (aroK), HD0444 (aroF), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to 3-phosphoshikimate 1-carboxyvinyltransferase from Haemophilus somnus (1703402), Pasteurella haemolytica (8488964), H. influenzae (1168501), among others. HD1383 is 68% similar to residues 1-428 from AROA_HAESO.

HD1383 is similar to 3-phosphoshikimate 1-carboxyvinyltransferase from C. pneumoniae (CPn1039) and C. trachomatis (CT366). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0128
COG name: 5-enolpyruvylshikimate-3-phosphate synthase
Functional Class:  E
The phylogenetic pattern of COG0128 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001986 (EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)) with a combined E-value of 2.1e-144.
    IPB001986A    17-57
    IPB001986B    93-103
    IPB001986C    120-146
    IPB001986D    176-188
    IPB001986E    204-220
    IPB001986F    246-258
    IPB001986G    277-291
    IPB001986H    324-376
    IPB001986I    389-401


ProDom Summary:  Protein Domain Search
Residues 9-427 are 69% similar to a (TRANSFERASE SYNTHASE 1-CARBOXYVINYLTRANSFERASE) protein domain (PD001867) which is seen in AROA_PASHA.



Paralogs:  Local Blast Search
HD1383 is paralogously related to HD0253 (3e-09).


Pfam Summary:  Pfam Search
Residues 11 to 428 (E-value = 2.3e-198) place HD1383 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

PDB Hit:
pdb|1G6S|A Chain A, Structure Of Epsp Synthase Liganded With Sh... 473 1e-134
pdb|1EPS| 5-Enol-Pyruvyl-3-Phosphate Synthase (E.C.2.5.1.9) 471 6e-134

Gene Protein Sequence:
MNTIEKIRLDPITRIEGEITLPGSKSLSNRALLLAALAKGTTRVTNLLVS
DDVEHMLNALQTLGIRYTLSQDKRECIVEGACGALAWQNGLSLFLGNAGT
VMRPLAAVLCLKGEVRAEVVLTGEARMQQRPIQHLVDALRQAGANIEYLE
NQGYPPLAIKNTGLIGGKIQIDGSISSQFLTALLMVAPLAESDMQIEIVG
DLVSKPYIDMTLAMMRDFGVVVQNNNYQSFFVQAQQCYLSPGQYWVEGDA
SSASYFLAAAAIKGKVKVNGIGKNSIQGDRLFADVLAKMGANISWGEDFI
QAEKSVLRGIDVDLNHIPDAAITIAIVALFAETETIIRNVYNWRVKETDR
LSAMATELRKLGATVEEGQDFIRIQPLALTDFETAEIETYNDHRIAMCFS
LIALSNTAVTILDPQCTRKTFPNYFAEFEKLWRKN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACAATCGAAAAGATTAGGTTAGATCCTATTACGCGTATTGAGGG
CGAGATTACTTTACCCGGCTCAAAAAGCCTTTCAAACCGAGCATTGTTAT
TAGCCGCGTTAGCGAAAGGCACGACGCGCGTGACTAATTTATTAGTGAGT
GATGATGTTGAGCATATGTTGAATGCCTTACAAACATTAGGGATTCGTTA
TACGCTTTCACAAGATAAACGAGAATGTATAGTTGAAGGCGCTTGTGGAG
CATTAGCTTGGCAGAATGGCTTGTCTTTATTTTTAGGTAACGCCGGCACA
GTAATGCGCCCTTTAGCAGCCGTGTTGTGTTTAAAAGGTGAAGTGCGTGC
GGAAGTTGTATTAACGGGTGAAGCGCGTATGCAACAGCGCCCTATTCAGC
ATTTAGTTGATGCATTACGACAAGCAGGTGCCAACATAGAGTATTTAGAA
AATCAAGGTTATCCACCGCTAGCCATTAAAAATACTGGCTTAATCGGTGG
TAAAATTCAAATTGATGGTTCTATTTCCAGCCAATTTTTAACCGCATTAT
TGATGGTGGCGCCGTTGGCTGAATCTGATATGCAAATAGAGATTGTGGGT
GATTTAGTTTCCAAGCCTTATATAGATATGACGCTCGCGATGATGCGTGA
TTTTGGGGTAGTGGTACAAAATAATAATTATCAAAGCTTTTTCGTCCAAG
CTCAGCAATGTTACCTTTCACCAGGACAATATTGGGTGGAAGGCGATGCT
TCATCGGCTTCTTATTTTTTAGCGGCAGCTGCGATTAAAGGCAAAGTTAA
AGTGAATGGCATTGGTAAAAATTCTATTCAAGGTGACCGCTTATTTGCAG
ATGTATTAGCTAAAATGGGCGCTAATATCAGTTGGGGAGAAGATTTCATT
CAAGCGGAAAAATCCGTATTACGAGGCATTGATGTCGATCTAAATCATAT
TCCTGATGCGGCAATAACTATCGCTATAGTCGCACTGTTTGCCGAAACCG
AAACGATCATTCGTAATGTATATAATTGGCGTGTGAAAGAAACTGATCGA
TTAAGCGCGATGGCGACAGAATTGCGTAAATTAGGTGCAACTGTCGAAGA
AGGGCAAGATTTTATTCGTATTCAACCGCTTGCATTAACCGATTTTGAAA
CAGCGGAAATTGAAACGTATAATGATCATCGTATAGCCATGTGTTTTTCT
TTAATTGCACTTTCAAATACTGCAGTGACCATTTTAGATCCCCAATGTAC
CCGCAAAACGTTTCCAAATTATTTTGCGGAATTTGAAAAATTATGGCGGA
AAAACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy