Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1010 IGR1011 IGR1012 IGR1013 IGR1009 IGR1008 IGR1014 IGR1007 HD1377 lysC, - HD1375 HD1376 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1377 lysC, - HD1375 HD1376 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1377 lysC, - HD1375 HD1376 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 ppx, - HD1378 topA, - HD1385 HD1381 HD1381
* Calculated from Protein Sequence

Gene ID: HD1382

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
serC  

Definition:
phosphoserine transaminase

Gene Start:
1128235

Gene Stop:
1129323

Gene Length:
1089

Molecular Weight*:
40099

pI*:
6.70

Net Charge*:
-1.73

EC:
2.6.1.52  

Functional Class:
Amino acid biosynthesis; Glycine-serine family  

Pathway: pathway table
Glycine, serine and threonine metabolism
Vitamin B6 metabolism

Secondary Evidence:
O"Gaora,P., Maskel,D., Coleman,D., Cafferkey,M. and Dougan,G. Cloning and characterisation of the serC and aroA genes of Yersinia enterocolitica, and construction of an aroA mutant.
Gene 84(1): 23-30, 1989.
Medline: 90108713.

Duncan,K. and Coggins,J.R.
The serC-aro A operon of Escherichia coli. A mixed function operon encoding enzymes from two different amino acid biosynthetic pathways.
Biochem. J. 234(1):49-57, 1986.
Medline: 86215119.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to phosphoserine transaminase from H. influenzae (1173430), Yersinia enterocolitica (134441), E. coli (2506180), among others. HD1382 is 68% similar to residues 1-359 from SERC_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1932
COG name: Phosphoserine aminotransferase
Functional Class:  H,E
The phylogenetic pattern of COG1932 is ----y---eb-h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003248 (Phosphoserine aminotransferase) with a combined E-value of 1.1e-173.
    IPB003248A    6-39
    IPB003248B    57-87
    IPB003248C    94-110
    IPB003248D    146-158
    IPB003248E    174-216
    IPB003248F    239-286
    IPB003248G    295-310
    IPB003248H    325-357


ProDom Summary:  Protein Domain Search
Residues 223-354 are 73% similar to a (AMINOTRANSFERASE BIOSYNTHESIS) protein domain (PD001544) which is seen in SERC_PASMU.

Residues 56-204 are 75% similar to a (AMINOTRANSFERASE BIOSYNTHESIS) protein domain (PD339374) which is seen in SERC_PASMU.



Paralogs:  Local Blast Search
HD1382 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 350 (E-value = 7.1e-107) place HD1382 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

PDB Hit:
pdb|1BJO|A Chain A, The Structure Of Phosphoserine Aminotransfe... 359 3e-100
pdb|1BJN|A Chain A, Structure Of Phosphoserine Aminotransferase... 357 1e-099
pdb|1BT4|A Chain A, Phosphoserine Aminotransferase From Bacillu... 280 2e-076

Gene Protein Sequence:
MKHVYNFSAGPAMMPKAVLAQAQQELLNWQQQGTSVMEVSHRSNAFMALA
TQTEQDLRQLYAIPDNYKVLFLQGGAHGQFAAIPMNLIGKKGKALYLISG
HWSNRSAQEARNFCEVDQLNILTQDEAGVFSVNQTDFSDIAEQYDYVHYC
PNETISGVEIPDIPIVGKAVLVADMSSNILSRNIDISKFGLIYAGAQKNL
GPAGITIVIIRQDLIGNAQRATPSIWNYATQVNADSMINTPPTFAWYLCS
LVFKHLRAAGGLASVEQRNQQKAALLYQYLDNSHFYHNYVAPQNRSLMNV
TFTTNNDELNAKFVAEAAENGLHALKGHKVVGGMRASIYNAMPLDGVEAL
IEFMQKFAQENR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACACGTTTATAATTTTAGTGCCGGGCCTGCGATGATGCCTAAAGC
TGTTTTAGCACAAGCACAACAAGAATTATTAAATTGGCAACAGCAAGGTA
CTTCCGTAATGGAAGTCAGTCATCGAAGTAATGCTTTTATGGCGCTTGCC
ACTCAAACTGAACAAGATCTTCGACAATTATATGCTATACCCGATAATTA
TAAAGTTTTGTTTTTACAAGGTGGTGCTCACGGACAATTTGCTGCAATTC
CGATGAATTTAATTGGCAAGAAAGGCAAAGCGCTTTATTTAATTAGTGGG
CATTGGTCAAACCGTTCTGCGCAAGAAGCTCGTAATTTTTGTGAGGTCGA
TCAGCTTAATATATTAACTCAAGATGAAGCGGGTGTTTTTTCGGTTAATC
AGACAGATTTTAGCGATATTGCTGAGCAATATGATTATGTTCATTATTGT
CCAAATGAAACAATCAGTGGCGTTGAAATTCCGGATATTCCGATTGTCGG
TAAAGCGGTATTAGTGGCTGATATGTCTTCTAATATTCTTTCACGTAATA
TTGATATTAGCAAATTTGGCTTAATTTATGCGGGAGCTCAAAAAAATTTA
GGTCCTGCGGGCATCACTATTGTGATTATTCGGCAAGATTTAATCGGTAA
TGCACAGCGTGCAACCCCGTCTATTTGGAATTATGCCACGCAAGTGAATG
CGGACTCAATGATTAATACGCCGCCTACATTTGCTTGGTATCTTTGTTCA
TTAGTTTTTAAACATTTACGTGCAGCAGGTGGTTTAGCTAGCGTCGAGCA
ACGCAATCAGCAAAAAGCGGCATTATTGTACCAATATTTAGATAACAGCC
ATTTTTATCATAATTATGTTGCCCCCCAAAATCGTTCATTAATGAATGTA
ACCTTTACTACTAATAATGACGAATTAAATGCAAAATTTGTAGCGGAAGC
GGCAGAAAATGGTTTACACGCGCTAAAAGGGCATAAAGTTGTAGGCGGTA
TGCGTGCTTCGATTTATAATGCGATGCCATTAGATGGTGTTGAGGCGTTA
ATTGAATTTATGCAAAAATTTGCACAAGAAAACCGTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy