Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1010 IGR1011 IGR1012 IGR1006 IGR1013 IGR1009 IGR1008 IGR1007 HD1377 lysC, - HD1375 HD1376 HD1374 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 dnaB, - HD1372 ppx, - HD1378 HD1377 lysC, - HD1375 HD1376 HD1374 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 dnaB, - HD1372 ppx, - HD1378 HD1377 lysC, - HD1375 HD1376 HD1379 HD1380 serC, - HD1382 aroF,aroA, - HD1383 argA, - HD1384 dnaB, - HD1372 ppx, - HD1378 HD1381 HD1373 HD1374 HD1381 HD1373
* Calculated from Protein Sequence

Gene ID: HD1378

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ppx  

Definition:
exopolyphosphatase/ metaphosphatase

Gene Start:
1125044

Gene Stop:
1126567

Gene Length:
1524

Molecular Weight*:
57729

pI*:
7.70

Net Charge*:
3.22

EC:
 3.6.1.11  

Functional Class:
Central intermediary metabolism; Phosphorus compounds  

Pathway: pathway table
Central intermediary metabolism; Phosphorus compounds
Purine metabolism

Secondary Evidence:
Akiyama,M., Crooke,E. and Kornberg,A.
An exopolyphosphatase of Escherichia coli. The enzyme and its ppx gene in a polyphosphate operon.
J. Biol. Chem. 268(1):633-639, 1993.
Medline: 93107072.


Reizer,J., Reizer,A., Saier,M.H. Jr., Bork,P. and Sander,C. Exopolyphosphate phosphatase and guanosine pentaphosphate phosphatase belong to the sugar kinase/actin/hsp 70 superfamily. Trends Biochem. Sci. 18(7):247-248, 1993.
Medline: 94025037.

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to exopolyphosphatase PPX/metaphosphatase from E. coli (130787), Salmonella typhimurium (3550418), H. influenzae (1172593), among others. HD1378 is 50% similar to 10-489 from PPX_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, T. pallidum, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0248
COG name: Exopolyphosphatase
Functional Class: F,P
The phylogenetic pattern of COG0248 is ----yqvcE-Rhuj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003695 (Ppx/GppA phosphatase) with a combined E-value of 3.8e-71.
    IPB003695A    15-26
    IPB003695B    69-122
    IPB003695C    138-178
    IPB003695D    207-221
    IPB003695E    268-278


ProDom Summary:  Protein Domain Search
Residues 15-308 are 28% similar to a (PROTEOME COMPLETE PHOSPHOHYDROLASE) protein domain (PD333125) which is seen in Q9KD26_BACHD.

Residues 112-306 are 63% similar to a (PROTEOME COMPLETE PM1807 PYROPHOSPHATASE) protein domain (PD329240) which is seen in Q9CK28_PASMU.

Residues 12-111 are 78% similar to a (EXOPOLYPHOSPHATASE PROTEOME COMPLETE) protein domain (PD291080) which is seen in Q9CK28_PASMU.

Residues 112-319 are 62% similar to a (HYDROLASE EXOPOLYPHOSPHATASE PROTEOME) protein domain (PD214693) which is seen in PPX_HAEIN.

Residues 314-428 are 51% similar to a (EXOPOLYPHOSPHATASE PROTEOME COMPLETE HYDROLASE) protein domain (PD024479) which is seen in Q9CK28_PASMU.

Residues 17-302 are 24% similar to a (PROTEOME COMPLETE PHOSPHATASE POSSIBLE) protein domain (PD319756) which is seen in Q9PN60_CAMJE.

Residues 15-104 are 82% similar to a (HYDROLASE EXOPOLYPHOSPHATASE COMPLETE) protein domain (PD006401) which is seen in PPX_HAEIN.



Paralogs:  Local Blast Search
HD1378 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 27 to 310 (E-value = 1e-117) place HD1378 in the Ppx-GppA family which is described as Ppx/GppA phosphatase family (PF02541)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPVSQSQHFAPREFAAIDLGSNSFHMIVARIVNGSIQVLSRLKRRVRLAD
GLNEERVLSQEAIERGVNCLSLFSDRLQGFDVENVKVVGTYTLRRAVNND
EFLQQAAKVFPYPIQIISGQEEARLIYAGVSHTQPEKGRKLVIDIGGGST
EIAVGDDFSPLRVESRHMGCVSFAKRFFPEGQLTAEYFEQAYQTAIEKIE
DLAWEYRELGWENVLGSSGTVKTVQKVLVAQGYRDGLITTARLKILVERC
LQFTSLYNIQMKGLVEERADVLVPGLAILLALFDTFKIEAMRYSDGALRE
GVMYGLEQAFQVSDIRQRTAEGLAEQFNIDQQQAQRVEKTALALFEQVKN
WRNHRQVSELRSILKWASLLHEIGIVINHNGIHKHSAYIIAHRDLPGFDV
EQQHLLAILMRFHLKAFKCSDIRSTNRYQHRDILTLLRLFRLAVLLNRSR
QAAVFPQILTLKTEKNHWQISFDLDFLTKNPLVLADLEEEQQYLAALGLY
LQITSLS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGTTTCTCAATCTCAACATTTTGCTCCTCGTGAATTTGCTGCCAT
TGATCTTGGTTCAAATAGTTTTCATATGATTGTGGCACGGATTGTTAACG
GTTCTATCCAAGTATTGTCGCGTTTAAAGCGACGAGTTAGGTTGGCAGAT
GGTTTAAATGAAGAACGGGTGTTAAGCCAAGAAGCGATTGAACGAGGCGT
TAATTGTTTATCATTGTTTTCTGACCGGTTGCAGGGGTTTGACGTTGAAA
ATGTCAAAGTGGTCGGCACTTATACGTTACGCCGTGCCGTTAATAATGAT
GAATTTTTACAACAAGCAGCAAAAGTATTTCCTTATCCGATTCAAATTAT
CTCTGGGCAAGAAGAGGCGCGTTTAATTTATGCGGGGGTTAGCCATACTC
AGCCAGAAAAAGGGCGTAAATTAGTCATTGATATTGGCGGTGGTTCAACA
GAAATCGCTGTTGGCGATGATTTCTCACCATTACGTGTTGAAAGTCGTCA
TATGGGCTGTGTTAGCTTTGCTAAGCGATTTTTTCCTGAAGGTCAATTGA
CTGCCGAATACTTTGAACAAGCGTATCAAACCGCAATTGAGAAGATTGAG
GATTTAGCTTGGGAATATCGAGAATTAGGTTGGGAAAATGTGCTAGGTTC
ATCAGGCACTGTGAAAACGGTGCAAAAAGTGCTAGTGGCACAAGGATATC
GAGATGGCTTGATTACCACAGCACGGTTAAAAATATTAGTTGAACGATGT
TTGCAATTTACTTCATTATATAATATTCAGATGAAAGGATTAGTCGAAGA
ACGCGCCGATGTGTTAGTGCCGGGCTTAGCCATTCTATTAGCGTTATTTG
ATACTTTTAAAATTGAGGCAATGCGTTATTCTGATGGCGCATTGCGCGAA
GGCGTGATGTATGGTTTAGAACAGGCATTTCAAGTCAGTGATATTCGACA
ACGTACCGCTGAAGGATTAGCAGAACAATTCAATATTGATCAACAGCAAG
CACAACGTGTAGAAAAAACGGCATTAGCGTTATTTGAACAAGTAAAAAAT
TGGCGCAATCATCGTCAAGTTTCTGAGTTACGTAGTATTTTAAAATGGGC
AAGCTTATTACATGAAATTGGGATTGTAATCAATCATAATGGTATCCATA
AACATTCAGCTTATATTATTGCACATCGCGATTTACCGGGGTTTGATGTT
GAACAACAACATTTATTGGCGATTTTAATGCGATTCCACTTAAAAGCATT
TAAATGCAGTGATATTCGTAGCACTAATCGTTATCAACACCGCGATATTT
TAACCTTATTACGTTTATTTCGTTTAGCCGTTTTATTAAATCGTTCTCGC
CAAGCGGCTGTTTTTCCTCAAATATTAACGCTTAAGACAGAAAAAAATCA
CTGGCAAATAAGTTTTGATTTAGATTTTTTAACTAAAAATCCTTTAGTGT
TAGCTGATTTAGAAGAAGAACAGCAATATTTAGCTGCATTAGGTTTATAT
TTGCAGATCACTTCGTTAAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy