Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1004 IGR1010 IGR1011 IGR1006 IGR1009 IGR1008 IGR1005 IGR1007 HD1377 HD1371 HD1370 lysC, - HD1375 HD1376 HD1374 HD1379 HD1380 serC, - HD1382 dnaB, - HD1372 ppx, - HD1378 HD1377 HD1371 HD1370 lysC, - HD1375 HD1376 HD1374 HD1379 HD1380 serC, - HD1382 dnaB, - HD1372 ppx, - HD1378 HD1377 HD1371 HD1370 lysC, - HD1375 HD1376 HD1379 HD1380 dnaB, - HD1372 ppx, - HD1378 HD1381 HD1373 HD1374 serC, - HD1382 HD1381 HD1373
* Calculated from Protein Sequence

Gene ID: HD1375

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lysC  

Definition:
lysine-sensitive aspartokinase III

Gene Start:
1124039

Gene Stop:
1122684

Gene Length:
1356

Molecular Weight*:
49135

pI*:
5.90

Net Charge*:
-8.04

EC:
2.7.2.4  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Glycine, serine and threonine metabolism
Lysine biosynthesis

Secondary Evidence:
Velasco AM, Leguina JI, Lazcano A.
Molecular evolution of the lysine biosynthetic pathways.
J Mol Evol. 2002 Oct;55(4):445-59.
PMID: 12355264

Comment:
Does not appear to be a bifunctional enzyme coupled with homoserine dehydrogenase.

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to aspartokinase III from E. coli (416597), Arabidopsis thaliana (6091740, putative), Methanococcus jannaschii (2492982), among others. HD1375 is 57% similar to residues 1-449 from AK3_ECOLI.

HD1375 is similar to aspartokinase III from C. pneumoniae (CPn1049) and to aspartokinase I from C. trachomatis (CT362). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0527
COG name: Aspartokinases
Functional Class:  E
The phylogenetic pattern of COG0527 is amtKyqVcEBrHuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001341 (Aspartokinase, N-terminus) with a combined E-value of 5.3e-34.
    IPB001341A    4-16
    IPB001341B    36-46
    IPB001341C    118-128
    IPB001341D    195-228
    IPB001341E    422-448


ProDom Summary:  Protein Domain Search
Residues 119-293 are 75% similar to a (KINASE ASPARTOKINASE BIOSYNTHESIS) protein domain (PD000447) which is seen in Q9CM97_PASMU.

Residues 392-450 are 59% similar to a (KINASE ASPARTOKINASE BIOSYNTHESIS) protein domain (PD002283) which is seen in Q9CM97_PASMU.

Residues 298-391 are 68% similar to a (KINASE ASPARTATE TRANSFERASE) protein domain (PD013411) which is seen in Q9CM97_PASMU.



Paralogs:  Local Blast Search

HD1375 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 279 (E-value = 5.5e-57) place HD1375 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSHFSVAKFGGTSVADFNAMNACANIVVKDNHTRVVVLSASAGITNYLVE
LANGCAPLRRVEILQNVRSVQYNIIQQLQQPEAISAEIDRLLQHISVLAE
SASVTTSATLTDELIAHGELMSSKIFTQLLIEREIPAIWVDVRDVIATNS
HHGKATPDDKKTQQQADAIVKPLLEANKIIITQGFIARDQQGNTTTLGRG
GSDYSAALLAEVLSAKDVLIWTDVPGIYTTDPRIVPNAQRIATIAFNEAA
EMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPTCRPIF
RAIALRRNQTLVTLSSLAMLHAQEFLASVFSILAKYQVSVDIITTSEVSI
TLTLDKTDSTASTAQILSDALVHELSQFCHIKIENDLSLLAIIGNDLHLQ
QGIAKELFQTIEPFNIRLINYGASTNNIYMLVKNSDADHILLALHYDLFE
S$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCATTTTTCGGTTGCAAAATTTGGTGGCACAAGTGTCGCTGATTT
TAATGCAATGAATGCTTGTGCAAACATTGTTGTTAAAGATAACCATACAC
GCGTTGTGGTCCTATCCGCTTCAGCGGGAATCACTAATTACTTGGTTGAA
TTAGCGAATGGCTGTGCCCCATTACGCCGTGTAGAAATTCTGCAGAACGT
TCGAAGTGTCCAATACAATATTATACAACAACTACAACAACCTGAAGCTA
TTTCTGCAGAAATAGACCGATTACTGCAACATATCAGTGTCTTAGCTGAA
TCAGCCAGTGTAACAACATCTGCTACCCTAACTGATGAGTTGATTGCTCA
CGGTGAATTGATGTCGTCTAAAATATTTACGCAATTATTAATTGAAAGAG
AAATACCCGCTATATGGGTTGATGTTCGTGATGTAATCGCGACCAATAGC
CACCATGGTAAAGCAACACCTGATGATAAAAAAACACAACAGCAGGCAGA
TGCTATAGTCAAACCACTGCTTGAAGCAAATAAAATCATTATTACACAAG
GTTTTATTGCTCGCGATCAACAAGGAAACACCACAACGTTAGGGCGTGGT
GGATCAGACTACTCTGCGGCCTTATTAGCGGAAGTATTATCCGCCAAAGA
CGTTTTAATTTGGACTGATGTACCAGGAATTTATACGACAGATCCACGTA
TAGTACCCAATGCACAACGCATCGCCACCATCGCGTTCAATGAAGCGGCT
GAAATGGCTACATTTGGTGCAAAAGTCTTACATCCTGCCACATTATTACC
TGCCGTACGGAGTAACATTCCTGTTTATGTTGGATCGAGTAAAGCGCCAG
AACAAGGTGGAACGTGGGTAACACGTGATCCAACATGCCGCCCGATTTTT
CGAGCTATTGCGTTACGTCGTAACCAAACTTTAGTGACACTATCAAGCCT
TGCAATGCTACACGCCCAAGAATTTTTAGCGAGTGTCTTTTCTATACTAG
CCAAATACCAAGTTTCAGTTGATATTATCACTACATCAGAAGTCAGCATT
ACTTTAACATTAGATAAGACTGATTCTACCGCATCAACTGCACAAATATT
ATCGGACGCTTTAGTTCACGAATTAAGTCAATTTTGCCATATAAAAATTG
AAAATGACCTTAGCCTACTTGCAATTATTGGCAATGATCTACATTTACAA
CAAGGCATTGCTAAAGAATTATTTCAGACAATTGAACCCTTTAATATTCG
TTTAATTAACTATGGCGCCAGTACCAATAATATTTATATGTTAGTAAAAA
ATAGCGATGCAGATCATATCTTGCTTGCTTTACACTACGACCTATTTGAA
TCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy