Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1004 IGR1003 IGR1006 IGR1002 IGR1008 IGR1001 IGR1005 IGR1007 HD1377 HD1369 HD1371 HD1370 lysC, - HD1375 HD1376 HD1374 tgt, - HD1368 dnaB, - HD1372 ppx, - HD1378 HD1377 HD1369 HD1371 HD1370 lysC, - HD1375 HD1376 HD1374 tgt, - HD1368 dnaB, - HD1372 ppx, - HD1378 HD1377 HD1369 HD1371 HD1370 lysC, - HD1375 HD1376 tgt, - HD1368 dnaB, - HD1372 ppx, - HD1378 HD1373 HD1374 HD1373
* Calculated from Protein Sequence

Gene ID: HD1372

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaB  

Definition:
replicative DNA helicase dnaB

Gene Start:
1120451

Gene Stop:
1121887

Gene Length:
1437

Molecular Weight*:
53655

pI*:
5.60

Net Charge*:
-8.59

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Wong,A., Kean,L. and Maurer,R.
Sequence of the dnaB gene of Salmonella typhimurium
J. Bacteriol. 170 (6), 2668-2675 (1988)
Medline: 88227847

Nakayama,N., Arai,N., Bond,M.W., Kaziro,Y. and Arai,K.
Nucleotide sequence of dnaB and the primary structure of the dnaB
protein from Escherichia coli
J. Biol. Chem. 259 (1), 97-101 (1984)
Medline: 84161990


Comment:
For other "dna" genes, see HD0973 (dnaB), HD1771 (dnaJ), HD1819 (dnaX), HD0189 (dnaK), HD1935 (dnaX), HD0551 (dnaE), HD0690 (dnaG), HD0850 (dnaN), HD0851 (dnaA)

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to replicative DNA helicase from H. influenzae (1169367), Salmonella typhimurium (79069), E. coli (118713), among others. HD1372 is 68% similar to residues 47-504 from DNAB_HAEIN.

HD1372 is similar to replicative DNA helicase from C. trachomatis (CT497), C. pneumoniae (CPn0616), T. pallidum (TP0058), M. genitalium (MG094), M. pneumoniae (MP0599). and U. urealyticum (UU550).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class: L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001198 (DnaB helicase) with a combined E-value of 6.1e-150.
    IPB001198A    13-23
    IPB001198B    99-115
    IPB001198C    195-233
    IPB001198D    258-297
    IPB001198E    340-353
    IPB001198F    359-407
    IPB001198G    439-464


ProDom Summary:  Protein Domain Search
Residues 190-391 are 42% similar to a (ATP-BINDING DNA-BINDING RECOMBINATION DAMAGE REPAIR) protein domain (PD000229) which is seen in Q9X258_THEMA.

Residues 401-457 are 60% similar to a (HELICASE PROTEOME COMPLETE DNA) protein domain (PD270107) which is seen in Q9X258_THEMA.

Residues 38-192 are 59% similar to a (HELICASE REPLICATIVE REPLICATION) protein domain (PD002663) which is seen in DNAB_HAEIN.

Residues 407-464 are 63% similar to a (HELICASE REPLICATIVE REPLICATION) protein domain (PD270109) which is seen in Q9MC54_BPD3.

Residues 277-406 are 33% similar to a (HELICASE REPLICATIVE REPLICATION ATP-BINDING DNA-BINDING) protein domain (PD332834) which is seen in DNAB_MYCLE.

Residues 407-464 are 55% similar to a (PLASMID HELICASE DNA REPLICATIVE) protein domain (PD399735) which is seen in Q9Z7T8_CHLPN.

Residues 407-467 are 88% similar to a (HELICASE REPLICATIVE PROTEOME COMPLETE) protein domain (PD003017) which is seen in DNAB_ECOLI.



Paralogs:  Local Blast Search
HD1372 is paralogously related to HD0973 (9e-91).


Pfam Summary:  Pfam Search
Residues 11 to 113 (E-value = 1.1e-51) place HD1372 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 189 to 406 (E-value = 5.4e-132) place HD1372 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

PDB Hit:
pdb|1B79|B Chain B, N-Terminal Domain Of Dna Replication Protei... 150 3e-037
pdb|1JWE|A Chain A, Nmr Structure Of The N-Terminal Domain Of E... 145 9e-036

Gene Protein Sequence:
MRDKQVENIAISPHSIEAEQAVLGGIMLSNEHWDNVVERIQASDFYNYAH
RTIFEQMVELMRNNQPIDIITLDQALKAKGVLQDVGGFAYLAELSKNTPS
AANILAYADIVRDRSDLRGVILASNQIAEMAYHTKGRSAKDVLDEAERVV
FEIAEKRHASNEGPQKIDHILLNTLARIELLSKNRNNGGVTGISTGFIDL
NKKTAGLQPSDLIIVAARPSMGKTTFAMNLCENASLHDIEDHNDLDENGN
PRKKPAKPVLIFSLEMPADQIMMRMLASLSRVNQTKIRTGQIHDDEEWAK
ISSTVAILQERKNIFIDDSAGLTPTELRSRARRIYRENGGLSLIMVDYLQ
LMRVPNFSDNRTLEIAEISRSLKALAKELEVPVVALSQLNRSLEQRQDKR
PVNSDLRESGSIEQDADLIMFIYRDEVYHSESDLKGVAEIIIGKQRNGPI
GRVKLTFQGQYSRFDNYTGTGDVYSDEF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAGATAAACAAGTTGAAAATATTGCTATTTCTCCTCATTCAATTGA
AGCTGAGCAAGCGGTGTTGGGGGGAATCATGCTCAGTAATGAACATTGGG
ATAATGTAGTAGAGCGTATTCAAGCAAGTGATTTTTATAATTATGCGCAT
CGTACTATTTTCGAACAGATGGTGGAGTTGATGCGTAATAATCAACCGAT
TGATATTATTACGCTTGATCAAGCATTAAAGGCTAAAGGCGTGCTACAAG
ATGTCGGTGGTTTTGCTTATTTAGCGGAATTATCTAAAAACACGCCAAGT
GCAGCAAATATATTAGCTTATGCGGATATTGTGCGCGATCGATCAGATTT
ACGTGGTGTTATTTTGGCGAGTAATCAAATTGCGGAGATGGCGTATCATA
CAAAGGGTAGAAGCGCTAAAGACGTATTAGATGAAGCTGAACGGGTCGTA
TTTGAAATTGCAGAAAAGCGTCATGCTAGCAATGAGGGGCCTCAAAAAAT
AGATCATATTTTGTTGAATACCTTAGCCCGTATTGAATTATTATCGAAAA
ATCGCAATAACGGTGGCGTAACCGGTATTTCGACCGGCTTTATTGATTTA
AATAAGAAAACGGCAGGATTACAGCCCTCTGATTTAATTATTGTTGCGGC
ACGGCCGTCAATGGGTAAAACCACATTTGCTATGAATCTTTGTGAGAATG
CCTCATTACATGATATTGAAGATCACAATGATCTAGATGAAAATGGTAAC
CCGCGTAAAAAACCGGCTAAACCGGTATTGATTTTTAGTTTAGAAATGCC
GGCTGATCAAATTATGATGCGGATGTTGGCTTCTTTATCACGTGTAAATC
AAACTAAAATTCGAACAGGGCAAATACACGATGATGAAGAATGGGCTAAG
ATCTCAAGCACGGTAGCCATTTTACAGGAACGGAAGAATATTTTTATTGA
TGATAGTGCCGGTTTAACGCCTACTGAACTTCGCTCGCGGGCTAGACGTA
TTTATCGAGAAAATGGTGGCTTAAGTTTGATTATGGTGGATTACTTGCAA
TTAATGCGTGTGCCGAATTTTTCAGATAATCGTACATTAGAAATTGCTGA
AATTTCTCGTTCTTTAAAAGCCTTAGCAAAAGAGTTAGAAGTGCCAGTTG
TTGCCCTTTCTCAGTTAAACCGAAGTCTCGAACAACGACAAGATAAACGT
CCGGTTAACTCAGATTTACGTGAATCAGGCTCTATTGAGCAAGACGCGGA
CTTAATTATGTTTATTTATCGTGATGAAGTTTATCATTCCGAATCGGATT
TAAAAGGCGTGGCGGAAATTATTATCGGTAAACAGCGTAATGGACCAATT
GGCCGTGTAAAATTGACGTTTCAAGGACAATACTCTAGATTTGATAACTA
TACGGGAACGGGAGATGTATATAGTGATGAATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy