Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1004 IGR996 IGR1003 IGR1000 IGR998 IGR1002 IGR997 IGR999 IGR1001 IGR1005 cspD, - HD1366 HD1361 HD1362 HD1367 HD1369 HD1371 cah, - HD1365 HD1370 HD1364 tgt, - HD1368 pmbA, - HD1363 dnaB, - HD1372 cspD, - HD1366 HD1361 HD1362 HD1367 HD1369 HD1371 cah, - HD1365 HD1370 HD1364 tgt, - HD1368 pmbA, - HD1363 dnaB, - HD1372 HD1362 HD1367 HD1369 HD1371 cah, - HD1365 HD1370 cspD, - HD1366 HD1361 HD1364 tgt, - HD1368 pmbA, - HD1363 dnaB, - HD1372 HD1373 HD1373
* Calculated from Protein Sequence

Gene ID: HD1368

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tgt  

Definition:
tRNA-guanine transglycosylase (tgt)

Gene Start:
1116292

Gene Stop:
1117440

Gene Length:
1149

Molecular Weight*:
43478

pI*:
7.40

Net Charge*:
1.82

EC:
2.4.2.29  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Reuter,K., Slany,R., Ullrich,F. and Kersten,H.
Structure and organization of Escherichia coli genes involved in
biosynthesis of the deazaguanine derivative queuine, a nutrient
factor for eukaryotes
J. Bacteriol. 173 (7), 2256-2264 (1991)
Medline: 91177815

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to queuine tRNA-ribosyltransferase from H. influenzae (1174661), E. coli (96354), Shigella flexneri (2498994), among others. HD1368 is 85% similar to residues 1-378 from TGT_HAEIN .

HD1368 is similar to tRNA-guanine transglycosylase (queuine tRNA ribosyltransferase) from (CPn0219) and CT193().
No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0343
COG name: Queuine/archaeosine tRNA-ribosyltransferase
Functional Class: J
The phylogenetic pattern of COG0343 is AmTk-qvceb-huj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002616 (Queuine tRNA-ribosyltransferase) with a combined E-value of 8.2e-138.
    IPB002616A    29-39
    IPB002616B    62-103
    IPB002616C    127-152
    IPB002616D    187-219
    IPB002616E    240-280
    IPB002616F    307-323


ProDom Summary:  Protein Domain Search
Residues 130-367 are 86% similar to a (TRANSFERASE TRNA-RIBOSYLTRANSFERASE) protein domain (PD004261) which is seen in TGT_HAEIN.

Residues 4-106 are 79% similar to a (TRANSFERASE TRNA-RIBOSYLTRANSFERASE) protein domain (PD004830) which is seen in TGT_SHIFL.

Residues 2-129 are 85% similar to a (QUEUINE TRANSFERASE) protein domain (PD348167) which is seen in TGT_HAEIN.



Paralogs:  Local Blast Search

HD1368 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 130 to 368 (E-value = 1.3e-161) place HD1368 in the TGT family which is described as Queuine tRNA-ribosyltransferase (PF01702)

PDB Hit:
pdb|1F3E|A Chain A, A New Target For Shigellosis: Rational Desi... 428 7e-121
pdb|1EFZ|A Chain A, Mutagenesis And Crystallographic Studies Of... 427 2e-120
pdb|1WKE| Trna-Guanine Transglycosylase 425 6e-120

Gene Protein Sequence:
MMKYELKSTSGMARRGRLTFSRPQGECYVETPAFMPVGTYGTVKGMTPEE
VKATGAQILLGNTFHLWLRPGQEIMKMHGDLHDFMQWHGPILTDSGGFQV
LSLGKLRKIKEEGVTFQNPISGEKIFLSPEKSMEIQYDLGSDIVMIFDEC
TPYPATLEYAKKSMEMSLRWAKRSRTRFDELANPRALFGIVQGSTYEELR
RESVKGLINIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPQDKPRYLMG
VGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSDGVVKIRNAKYKNDT
TPLDAECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAQI
RQAIEQDCFDEFVVEFYAKIGKEVPPLHLKSE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAATATGAATTAAAAAGTACAAGTGGAATGGCGCGCCGAGGGCG
TTTAACGTTTTCGCGTCCACAAGGTGAATGTTATGTTGAAACGCCCGCAT
TTATGCCGGTTGGGACTTATGGCACGGTAAAAGGCATGACGCCGGAAGAA
GTGAAAGCAACAGGCGCTCAGATTTTATTAGGTAACACGTTCCATCTGTG
GCTTCGCCCAGGTCAAGAAATTATGAAAATGCATGGTGATTTACATGATT
TTATGCAATGGCACGGGCCAATTTTAACTGATTCAGGTGGTTTTCAGGTC
CTTAGTTTAGGTAAATTGCGTAAAATTAAAGAAGAGGGCGTTACTTTTCA
AAATCCAATTAGTGGTGAGAAAATTTTTCTGTCGCCAGAAAAATCAATGG
AAATCCAATACGATTTAGGCTCAGATATCGTGATGATTTTTGATGAATGT
ACGCCATATCCTGCAACCCTTGAGTACGCTAAAAAATCAATGGAAATGTC
GTTACGTTGGGCAAAACGTAGTCGAACTCGTTTTGATGAGCTTGCTAATC
CTCGCGCATTATTTGGTATTGTTCAAGGCAGTACATACGAAGAATTACGT
AGAGAATCAGTAAAAGGGTTAATCAATATTGGTTTTGATGGTTATGCGGT
AGGTGGTTTGGCTGTGGGTGAACCAAAAGAAGAAATGCATCGAATTCTGG
AGTTTACTACACCATTATTACCGCAAGATAAACCGCGTTATTTAATGGGC
GTGGGTAAACCAGAAGATTTAGTAGAAGGTGTTCGCCGTGGTATAGATAT
GTTTGATTGCGTGATGCCAACCCGTAATGCGCGTAATGGCCATTTATTTG
TAAGTGATGGTGTAGTGAAAATCCGAAATGCCAAATATAAAAATGATACT
ACGCCATTAGATGCTGAATGTGATTGTTATACTTGTAAAAATTACACGAA
AGCATACCTTTATCATCTAGATAAATGCGGTGAAATTTTAGGCGCTCGTT
TAAATACAATTCATAATTTACGCTATTATCAACGTTTAATGGCACAAATT
CGCCAAGCAATTGAACAAGATTGTTTCGATGAGTTTGTCGTTGAATTTTA
TGCAAAAATAGGTAAGGAGGTGCCGCCATTACACCTCAAGTCTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy