Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1004 IGR994 IGR995 IGR996 IGR1003 IGR1000 IGR998 IGR1002 IGR997 IGR999 IGR1001 IGR1005 cspD, - HD1366 HD1361 HD1359 HD1362 HD1367 HD1369 pad, - HD1360 HD1371 cah, - HD1365 HD1370 HD1364 tgt, - HD1368 pmbA, - HD1363 dnaB, - HD1372 cspD, - HD1366 HD1361 HD1359 HD1362 HD1367 HD1369 pad, - HD1360 HD1371 cah, - HD1365 HD1370 HD1364 tgt, - HD1368 pmbA, - HD1363 dnaB, - HD1372 HD1362 HD1367 HD1369 pad, - HD1360 HD1371 cah, - HD1365 HD1370 cspD, - HD1366 HD1361 HD1359 HD1364 tgt, - HD1368 pmbA, - HD1363 dnaB, - HD1372
* Calculated from Protein Sequence

Gene ID: HD1367

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1116111

Gene Stop:
1115521

Gene Length:
591

Molecular Weight*:
22317

pI*:
10.20

Net Charge*:
6.47

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 33-189 are 35% similar to 16122278 putative lipoprotein [Yersinia pestis]. Otherwise, two significant hits using gapped BLAST to hypothetical protein from E. coli (140385) and Salmonella typhimurium (731345). HD1367 is 34% similar to residues 27-180 from YCEB_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 33-189 are 34% similar to a (YCEB) protein domain (PD103888) which is seen in YCEB_ECOLI.



Paralogs:  Local Blast Search
HD1367 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 195 (E-value = 8e-21) place HD1367 in the DUF1439 family which is described as Protein of unknown function (DUF1439) (PF07273)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTRKQMKTLVNRLFIISTFLLTSVQSYANFIDISEQQINQYLATKLTEKF
RMQDQIGIPGLFQLNYHLHNLTTQIGRTDANKVSLSGIIDGVLLLKGKSY
DAQLNLNIDTTPYYDTKTGKLYLKDIRLLNYSASPEKYQDKLQAFLPLLV
DGLSKMLNNTPIYTLDENKTQEALLKKFGKAIVIEQGKLSLQTALF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAGGAAACAAATGAAAACTTTAGTTAATCGATTATTTATAATCAG
TACATTCCTTTTAACTAGCGTACAAAGTTATGCAAATTTCATTGATATTA
GTGAACAACAGATCAACCAATATTTGGCAACAAAATTAACCGAAAAATTC
CGCATGCAAGATCAAATCGGTATACCGGGATTATTCCAATTAAATTACCA
TTTACATAATCTGACTACTCAAATTGGACGAACAGATGCTAACAAAGTGA
GTCTATCCGGCATTATTGATGGCGTTTTGCTACTGAAAGGTAAAAGCTAC
GATGCCCAACTTAATCTGAACATTGACACTACACCCTATTATGACACTAA
AACCGGTAAACTTTATCTAAAAGATATCCGCTTACTCAACTATAGTGCTA
GCCCTGAAAAATACCAAGATAAATTACAAGCGTTTTTACCATTATTAGTT
GACGGCTTGAGTAAAATGTTAAATAACACGCCTATCTATACCCTTGATGA
AAACAAAACTCAAGAAGCATTATTAAAGAAATTTGGTAAAGCGATTGTAA
TAGAACAAGGTAAATTAAGCCTACAAACGGCACTTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy